Category: Proteins & Peptides

Reference: 61700-50
€0.00 (tax incl.)
Source: human recombinant N-terminal His-tagged protein expressed in E. coli · MW: ~60 kDa • PPARs are members of the nuclear receptor family of ligand activated transcription factors that heterodimerize with...
Reference: 61700-25
€0.00 (tax incl.)
Source: human recombinant N-terminal His-tagged protein expressed in E. coli · MW: ~60 kDa • PPARs are members of the nuclear receptor family of ligand activated transcription factors that heterodimerize with...
Reference: 60880-10
€0.00 (tax incl.)
MW: 135 kDa • Source: recombinant enzyme; isolated from a Baculovirus overexpression system in Sf9 cells
Reference: 60500-5
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
Reference: 60500-25
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
Reference: 60500-10
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
Reference: 60500-1
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
Reference: 60100-5
€0.00 (tax incl.)
Isolated from ram seminal vesicles
Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
Reference: 360870-1
€0.00 (tax incl.)
Each vial contains nNOS (rat) to be used as a standard for WB and electrophoresis. The enzyme has been carefully purified to exclude all unrelated proteins; may not be catalytically active.(1281)
Reference: 360862-1
€0.00 (tax incl.)
Each vial contains 5 µg of iNOS (murine macrophage) to be used as a standard for WB and electrophoresis. The enzyme has been carefully purified to exclude all unrelated proteins; may not be catalytically active.
Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Reference: 360120-1
€0.00 (tax incl.)
Cyclooxygenase catalyzes the first step in the biosynthesis of prostaglandins, thromboxanes, and prostacyclins: the conversion of arachidonic acid to prostaglandin H2. Recent discoveries of the induction of...
Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
Reference: 360100-1
€0.00 (tax incl.)
To be used as a standard for WB and electrophoresis. This enzyme has been carefully purified to exclude all unrelated proteins; may not be catalytically active. • COX-1 catalyzes the first step in the biosynthesis of...
Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Reference: 32558-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged ARG1 expressed in HEK293 cells • Amino acids: 1-322 (full length) • MW: 36 kDa
Reference: 32093-20
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged CXCL12α expressed in E. coli • Amino acids: 22-89 • MW: 10 kDa
Reference: 32093-10
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged CXCL12α expressed in E. coli • Amino acids: 22-89 • MW: 10 kDa
Reference: 32091-50
€0.00 (tax incl.)
Source: Active recombinant INHBA expressed in HEK293 cells • Amino acids: 311-426 • MW: 13 kDa
Reference: 32091-10
€0.00 (tax incl.)
Source: Active recombinant INHBA expressed in HEK293 cells • Amino acids: 311-426 • MW: 13 kDa
Reference: 32088-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged IDS expressed in HEK293 cells • Amino acids: 26-550 • MW: 61 kDa
Reference: 32088-20
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged IDS expressed in HEK293 cells • Amino acids: 26-550 • MW: 61 kDa
Reference: 32087-20
€0.00 (tax incl.)
Source: Recombinant bovine C-terminal His-tagged enterokinase expressed in yeast • Amino acids: 801-1,035 • MW: 27.1 kDa
Reference: 32087-10
€0.00 (tax incl.)
Source: Recombinant bovine C-terminal His-tagged enterokinase expressed in yeast • Amino acids: 801-1,035 • MW: 27.1 kDa
Reference: 32086-50
€0.00 (tax incl.)
Source: Recombinant human C-terminal His-tagged VISTA expressed in HEK293 cells • Amino acids: 33-194 • MW: 19.6 kDa
Reference: 32086-100
€0.00 (tax incl.)
Source: Recombinant human C-terminal His-tagged VISTA expressed in HEK293 cells • Amino acids: 33-194 • MW: 19.6 kDa
Reference: 32085-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged CD47 expressed in HEK293 cells • Amino acids: 19-139 • MW: 15.2 kDa
Reference: 32085-200
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged CD47 expressed in HEK293 cells • Amino acids: 19-139 • MW: 15.2 kDa
Reference: 32080-5
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
Reference: 32080-20
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
Reference: 32080-100
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
Reference: 32080-1
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
Reference: 32079-50
€0.00 (tax incl.)
Source: Active recombinant mouse GM-CSF expressed in HEK293 cells • Amino acids: 18-141 • MW: 14.1 kDa
Reference: 32079-20
€0.00 (tax incl.)
Source: Active recombinant mouse GM-CSF expressed in HEK293 cells • Amino acids: 18-141 • MW: 14.1 kDa
Reference: 32079-1
€0.00 (tax incl.)
Source: Active recombinant mouse GM-CSF expressed in HEK293 cells • Amino acids: 18-141 • MW: 14.1 kDa
Reference: 32078-200
€0.00 (tax incl.)
Source: Active recombinant mouse IFN-γ expressed in HEK293 cells • Amino acids: 23-155 • MW: 15.5 kDa
Reference: 32078-100
€0.00 (tax incl.)
Source: Active recombinant mouse IFN-γ expressed in HEK293 cells • Amino acids: 23-155 • MW: 15.5 kDa
Reference: 32078-1
€0.00 (tax incl.)
Source: Active recombinant mouse IFN-γ expressed in HEK293 cells • Amino acids: 23-155 • MW: 15.5 kDa
Reference: 32077-50
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Reference: 32077-100
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Reference: 32077-1
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Reference: 32076-5
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
Reference: 32076-20
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
Reference: 32076-100
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
Reference: 32076-1
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
Reference: 32073-50
€0.00 (tax incl.)
Source: Active recombinant C-terminal human IgG1 Fc-His-tagged mouse PVR expressed in HEK293 cells • Amino acids: 28-345 • MW: 63 kDa
Reference: 32073-100
€0.00 (tax incl.)
Source: Active recombinant C-terminal human IgG1 Fc-His-tagged mouse PVR expressed in HEK293 cells • Amino acids: 28-345 • MW: 63 kDa
Reference: 32068-5
€0.00 (tax incl.)
Source: Active recombinant mouse VEGF-A 164 variant expressed in insect cells (baculovirus) • Amino acids: 27-190 • MW: 19.4 kDa
Reference: 32068-20
€0.00 (tax incl.)
Source: Active recombinant mouse VEGF-A 164 variant expressed in insect cells (baculovirus) • Amino acids: 27-190 • MW: 19.4 kDa
Reference: 32068-100
€0.00 (tax incl.)
Source: Active recombinant mouse VEGF-A 164 variant expressed in insect cells (baculovirus) • Amino acids: 27-190 • MW: 19.4 kDa

Menu

Settings