Category: Peptides

Filter By
Brand: Cayman Chemical Clear all
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Monoclonal) PAF Receptor Blocking Peptide (Monoclonal)

PAF Receptor Blocking Peptide (Monoclonal)

Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
sPLA2 (mouse Type V) Blocking Peptide sPLA2 (mouse Type V) Blocking Peptide

sPLA2 (mouse Type V) Blocking Peptide

Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
Prostaglandin E Synthase (cytosolic) Blocking Peptide Prostaglandin E Synthase (cytosolic) Blocking Peptide

Prostaglandin E Synthase (cytosolic) Blocking Peptide

Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
IP Receptor (mouse) Blocking Peptide IP Receptor (mouse) Blocking Peptide

IP Receptor (mouse) Blocking Peptide

Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
CysLT2 Receptor (N-Term) Blocking Peptide CysLT2 Receptor (N-Term) Blocking Peptide

CysLT2 Receptor (N-Term) Blocking Peptide

Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
CysLT2 Receptor (C-Term) Blocking Peptide CysLT2 Receptor (C-Term) Blocking Peptide

CysLT2 Receptor (C-Term) Blocking Peptide

Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
CysLT1 Receptor Blocking Peptide CysLT1 Receptor Blocking Peptide

CysLT1 Receptor Blocking Peptide

Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
RICK Blocking Peptide RICK Blocking Peptide

RICK Blocking Peptide

Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
EP4 Receptor (C-Term) Blocking Peptide EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
EP3 Receptor Blocking Peptide EP3 Receptor Blocking Peptide

EP3 Receptor Blocking Peptide

Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
EP2 Receptor Blocking Peptide EP2 Receptor Blocking Peptide

EP2 Receptor Blocking Peptide

Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
EP1 Receptor Blocking Peptide EP1 Receptor Blocking Peptide

EP1 Receptor Blocking Peptide

Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
PPARα Blocking Peptide PPARα Blocking Peptide

PPARα Blocking Peptide

Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
PPARγ Blocking Peptide PPARγ Blocking Peptide

PPARγ Blocking Peptide

Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
DP1 Receptor Blocking Peptide DP1 Receptor Blocking Peptide

DP1 Receptor Blocking Peptide

Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
Fatty Acid Amide Hydrolase Blocking Peptide Fatty Acid Amide Hydrolase Blocking Peptide

Fatty Acid Amide Hydrolase Blocking Peptide

Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Monoacylglycerol Lipase Blocking Peptide Monoacylglycerol Lipase Blocking Peptide

Monoacylglycerol Lipase Blocking Peptide

Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
β-Catenin Blocking Peptide β-Catenin Blocking Peptide

β-Catenin Blocking Peptide

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
HIF-1α (C-Term) Blocking Peptide HIF-1α (C-Term) Blocking Peptide

HIF-1α (C-Term) Blocking Peptide

Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
Optineurin (INT) Blocking Peptide Optineurin (INT) Blocking Peptide

Optineurin (INT) Blocking Peptide

Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
Optineurin (C-Term) Blocking Peptide Optineurin (C-Term) Blocking Peptide

Optineurin (C-Term) Blocking Peptide

Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Histone H1-derived Peptide (trifluoroacetate salt) Histone H1-derived Peptide (trifluoroacetate salt)

Histone H1-derived Peptide (trifluoroacetate salt)

Reference: 27439-1
€0.00 (tax incl.)
A peptide substrate for CRK3/CYC6; phosphorylated by CRK3/CYC6 and has been used in high-throughput screening assays for the identification of CRK3/CYC6 inhibitors
Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt) Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Reference: 27411-500
€0.00 (tax incl.)
An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-50
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-5
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-10
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
SureLight® 488 NHS ester SureLight® 488 NHS ester

SureLight® 488 NHS ester

Reference: 27091-100
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
SureLight® 488 NHS ester SureLight® 488 NHS ester

SureLight® 488 NHS ester

Reference: 27091-1
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-500
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-5
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-10
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-1
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-500
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-250
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-100
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-50
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-5
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-10
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-1
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Caveolin 1/3 Blocking Peptide Caveolin 1/3 Blocking Peptide

Caveolin 1/3 Blocking Peptide

Reference: 300830-200
€0.00 (tax incl.)
Peptide Sequence: rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF)(3942) · To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Polyclonal) PAF Receptor Blocking Peptide (Polyclonal)

PAF Receptor Blocking Peptide (Polyclonal)

Reference: 160604-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s PAF receptor polyclonal antiserum (Catalog No. 160602) to block protein-antibody complex formation during analysis for the PAF receptor.
BLT1 Receptor Blocking Peptide BLT1 Receptor Blocking Peptide

BLT1 Receptor Blocking Peptide

Reference: 120112-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...
N-acetyl-Pro-Gly-Pro Peptide N-acetyl-Pro-Gly-Pro Peptide

N-acetyl-Pro-Gly-Pro Peptide

Reference: 11189-5
€0.00 (tax incl.)
Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant. N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
N-acetyl-Pro-Gly-Pro Peptide N-acetyl-Pro-Gly-Pro Peptide

N-acetyl-Pro-Gly-Pro Peptide

Reference: 11189-25
€0.00 (tax incl.)
Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant. N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
Prolyl-glycyl-proline Peptide Prolyl-glycyl-proline Peptide

Prolyl-glycyl-proline Peptide

Reference: 11188-5
€0.00 (tax incl.)
Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
Prolyl-glycyl-proline Peptide Prolyl-glycyl-proline Peptide

Prolyl-glycyl-proline Peptide

Reference: 11188-25
€0.00 (tax incl.)
Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
GPR55 Blocking Peptide GPR55 Blocking Peptide

GPR55 Blocking Peptide

Reference: 10225-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s GPR55 Polyclonal Antibody to block protein-antibody complex formation during immunochemical analysis of GPR55 for WB
EP4 Receptor (N-Term) Blocking Peptide EP4 Receptor (N-Term) Blocking Peptide

EP4 Receptor (N-Term) Blocking Peptide

Reference: 101780-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI)(3164,3185,3186,2035) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody...

Menu

Settings

Please sign in first.

Sign in