Category: Peptides

Reference: 10005729-1
€0.00 (tax incl.)
Peptide Sequence: human 11β-HSD1 amino acids 78-92 (CLELGAASAHYLAGT) · To be used in conjunction with Cayman’s 11β-HSD1 polyclonal antibody (Catalog No. 10004303) to block protein-antibody complex formation during...
Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Reference: 10004457-200
€0.00 (tax incl.)
Immunogen: Synthetic peptide from the internal region of 15-LO-2 · To be used in conjunction with Cayman’s 15-LO-2 polyclonal antibody (Catalog No. 10004454) to block protein-antibody complex formation during...
Reference: 24319-500
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
Reference: 24319-250
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
Reference: 24319-100
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
Reference: 10006618-1
€0.00 (tax incl.)
Peptide Sequence: human 5-OxoETE receptor C-terminal amino acids 408-423 (KVQGEVSLEKEGSSQG) · To be used in conjunction with Cayman’s 5-OxoETE Receptor polyclonal antibody (Catalog No. 100025) to block...
Reference: 200200-50
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Reference: 200200-5
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Reference: 200200-10
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Reference: 200200-1
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Reference: 10008492-1
€0.00 (tax incl.)
Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) · To be used in conjunction with Cayman’s Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block...
Reference: AS09 527P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AGO1 | argonaute 1 before immunolocalization or western blot. Furter details are provided below.AGO1 belongs to a group of argonaute proteins which are...
Reference: AS12 2113P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AHK2 | Histidine kinase 2 before immunolocalization or western blot. Furter details are provided below.AHK2 (Histidine kinase 2) is a cytokinin receptor,...

AiF

Reference: 300-0P
€0.00 (tax incl.)
AiF ms PDCD8, PDCD 8
Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Reference: 278-0P
€0.00 (tax incl.)
Aldh1L1 rt FDH, FDN
Reference: 302-21P
€0.00 (tax incl.)
alpha-tubulin 4A hu Delta2-Tubulin, Glu-alpha-Tubulin, Tyr-alpha-Tubulin, TUBA1, alpha-Tubulin
Reference: 120-0P
€0.00 (tax incl.)
Amphiphysin rt AMPH
Reference: 155-0P
€0.00 (tax incl.)
AP180 rt pp155, NP185, F1-20, SNAP 91, AP 3, AP180, SNAP91
Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...

APP

Reference: 127-0P
€0.00 (tax incl.)
APP rt amyloid precursor protein
Reference: 296-0P
€0.00 (tax incl.)
ASPEP ms DNPEP, DAP, Aspartyl Aminopeptidase
Reference: 407-0P
€0.00 (tax incl.)
ATP1B2 ms AMOG, ATP1B2
Reference: AS09 312P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AtpC | gamma subunit of ATP synthase before immunolocalization or western blot. Furter details are provided below.ATP synthase produces ATP from ADP in the...
Reference: 112-2P
€0.00 (tax incl.)
beta SNAP ms Beta-soluble NSF attachment protein
Reference: 281-0P
€0.00 (tax incl.)
beta-Catenin ms CTNNB1, beta-Catenin, Catenin alpha-2, Catnb, CTNNB 1
Reference: 240-0P
€0.00 (tax incl.)
beta1-Integrin ms Integrins, VLA, CD 29, CD 61, CD29, CD61, Itgb3
Reference: 240-3P
€0.00 (tax incl.)
beta3-Integrin ms Integrins, VLA, CD 29, CD 61, CD29, CD61, Itgb3
Reference: 302-3P
€0.00 (tax incl.)
beta3-Tubulin ms TuJ1, TUBB3
Reference: 27411-500
€0.00 (tax incl.)
An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
Reference: 120112-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...
Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Reference: 24618-500
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
Reference: 24618-5
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
Reference: 24618-10
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
Reference: 24618-1
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
Reference: 226-0P
€0.00 (tax incl.)
c-Fos rt v-Fos
Reference: 301-0P
€0.00 (tax incl.)
Calmodulin rt CaM
Reference: 185-0P
€0.00 (tax incl.)
CASKIN1 rt
Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
Reference: 161-0P
€0.00 (tax incl.)
Caveolin1 rt Caveolin 1, Cav1
Reference: 300830-200
€0.00 (tax incl.)
Peptide Sequence: rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF)(3942) · To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex...
Reference: 10006591-1
€0.00 (tax incl.)
Peptide Sequence: CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 Receptor (C-Term) polyclonal antibody (Item No. 10006590) to block protein-antibody complex formation during...
Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Reference: 104-1P
€0.00 (tax incl.)
Cellubrevin rt VAMP 3, Synaptobrevin 3, Vamp 3, Vamp3, CEB
Reference: 10010251-1
€0.00 (tax incl.)
Peptide Sequence: synthetic peptide from human cRBP7 amino acids 125-134 (QVCKQTFQRA) · To be used in conjunction with Cayman’s Cellular Retinol Binding Protein 7 polyclonal antibody (Catalog No. 10010251) to block...
Reference: 442-0P
€0.00 (tax incl.)
Chil3 ms Chitinase-like protein 3, Beta-N-acetylhexosaminidase Ym1, ECF-L, Chitinase-3-like protein 3, Eosinophil chemotactic cytokine, Secreted protein Ym1, Chi3l3, Ym1
Reference: 10006790-1
€0.00 (tax incl.)
Peptide Sequence: murine amino acids 715-735 · To be used in conjunction with Cayman’s ChREBP polyclonal antibody (Catalog No. 10006789) to block protein-antibody complex formation during immunochemical analysis of...
Reference: 241-0P
€0.00 (tax incl.)
Claudin11 rt OSP, claudin11, Otm, Cldn11, OPS, Oligodendrocyte-specific protein
Reference: 253-2P
€0.00 (tax incl.)
CNIH2 ms Cornichon, CNIH 2, CNIH 3, CNIH2, CNIH3, Cornichon 2
Reference: 122-0P
€0.00 (tax incl.)
Complexin2 hu Synaphin 1, Synaphin 2, CPX 1, CPX 2, Complexin 1, Complexin 2, Complexin I, Complexin II, CPX I, CPX II, CPX1, CPX2, Cplx1, 2
Reference: 298-0P
€0.00 (tax incl.)
COX4 ms COX, COX IV, Cox4, Cox IV-1
Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
Reference: 415-0P
€0.00 (tax incl.)
Cpt1c ms CPT1c, CPTI-B
Reference: 10007003-1
€0.00 (tax incl.)
Peptide Sequence: CRTH2/DP2 protein amino acids 378-395 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (C-Term) polyclonal antibody (Catalog No. 10007002) to block protein-antibody complex formation...
Reference: 10004884-200
€0.00 (tax incl.)
Peptide Sequence: CRTH2/DP2 protein amino acids 2-21 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (N-Term) polyclonal antibody (Item No. 10004886) to block protein-antibody complex formation during...
Reference: 222-0P
€0.00 (tax incl.)
CtBP1 rt BARS, CtBP1
Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Reference: 382-0P
€0.00 (tax incl.)
Darpp32 ms PPP1R1B, DARPP32, DARPP-32, Dopamine- and cAMP-regulated neuronal phosphoprotein, Ppp1r1b
Reference: AS10 206S
€0.00 (tax incl.)
Dehydrins are stress proteins involved in formation of plant protective reactions against dehydration. They are normally synthesized in maturating seeds during their dessication, as well as in vegetative tissues of...
Reference: 10005516-200
€0.00 (tax incl.)
Peptide Sequence: human doppel protein amino acids 112-120 (ATQAANQGE) · To be used in conjunction with Cayman’s Doppel polyclonal antibody (Catalog No. 10005517) to block protein-antibody complex formation during...
Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
Reference: 115-0P
€0.00 (tax incl.)
Dynamin1 rt dynamin 1, dynamin 2, dynamin 3
Reference: 115-3P
€0.00 (tax incl.)
Dynamin3 ms dynamin 1, dynamin 2, dynamin 3
Reference: 250-1P
€0.00 (tax incl.)
EAAT1 rt GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3
Reference: 250-11P
€0.00 (tax incl.)
EAAT1 rt GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3
Reference: 250-2P
€0.00 (tax incl.)
EAAT2 ms GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3, GLT1
Reference: 250-31P
€0.00 (tax incl.)
EAAT3 rt GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3
Reference: 237-0P
€0.00 (tax incl.)
EEA1 rt EEA1, Early endosome antigen 1
Reference: 159-0P
€0.00 (tax incl.)
Endophilin1 ms SH3P4, SH3GL2, Endophilin 1, Endophilin A1, Endophilin A2, SH3P8, SH3GL1, Sh3 domain protein 2B
Reference: 10004111-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 19-32 (AGSPVPFGPEGRLE) · To be used in conjunction with Cayman’s endothelial lipase polyclonal antibody (Catalog No. 100030) to block protein-antibody complex formation during analysis...
Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
Reference: 101780-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI)(3164,3185,3186,2035) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody...
Reference: 143-0P
€0.00 (tax incl.)
Erc1b rt ERC, CAST, ERC 1b, ERC 2, CAST 1, CAST 2a, Erc1b, Cast2, ELKS, Cast2a
Reference: 143-1P
€0.00 (tax incl.)
ERC2 rt ERC, CAST, ERC 1b, ERC 2, CAST 1, CAST 2a, ELKS 2

Menu

Settings