Category: Peptides

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Reference: 321-0P
€0.00 (tax incl.)
VPS18 ms PEP 3, VPS 18, VPS18
Reference: 135-0P
€0.00 (tax incl.)
VGLUT1 rt BNPI, SLC17A7, VGLUT1
Reference: 131-0P
€0.00 (tax incl.)
VGAT rt VIAAT, SLC32A1
Reference: 279-0P
€0.00 (tax incl.)
VDAC1 ms Porin, VDAC 1
Reference: v5p-1
€0.00 (tax incl.)
1 mg V5-peptide.
Reference: 10004110-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 275-289 (VMSFSGQLLRATEHQ) · To be used in conjunction with Cayman’s TP receptor (mouse) polyclonal antibody (Item No. 101882) to block protein-antibody complex formation during analysis...
Reference: 10009368-1
€0.00 (tax incl.)
Antigen: human TP receptor C-terminal amino acids 323-343 (LSTRPRSLSLQPQLTQRSGLQ) · Host: rabbit · Cross-reactivity: (+) human, murine, rat, and Cos-7 (African green monkey) TP receptor; other species not tested...
Reference: 337-0P
€0.00 (tax incl.)
TorsinA hu DYT 1, Torsin 1A, Tor1a, Dyt1
Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Reference: 458-0P
€0.00 (tax incl.)
Tecpr1 rt Tectonin beta-propeller repeat-containing protein 1
Reference: 110-1BP
€0.00 (tax incl.)
Syntaxin1B rt p35, Syntaxin 1A, Syntaxin 1B, stx 1, stx 1A, stx 1B, stx1, p35B
Reference: 157-0P
€0.00 (tax incl.)
SynGAP rt p135 SynGAP, Neuronal RasGAP
Reference: 243-4P
€0.00 (tax incl.)
SynCAM4 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2, Cell adhesion molecule 4
Reference: 243-3P
€0.00 (tax incl.)
SynCAM3 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2
Reference: 243-2P
€0.00 (tax incl.)
SynCAM2 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2
Reference: 243-0P
€0.00 (tax incl.)
SynCAM1 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2
Reference: 102-0P
€0.00 (tax incl.)
Synaptoporin rt Synaptophysin 2, p38-2
Reference: 102-1P
€0.00 (tax incl.)
Synaptoporin rt Synaptophysin 2, p38-2
Reference: 101-0P
€0.00 (tax incl.)
Synaptophysin1 hu p38-1, Synaptophysin1
Reference: 145-1P
€0.00 (tax incl.)
Synaptojanin1 rt Synj1
Reference: 145-0P
€0.00 (tax incl.)
Synaptojanin1 rt Synj1
Reference: 103-02P
€0.00 (tax incl.)
Synaptogyrin2 rt Cellugyrin, Syngr2
Reference: 103-0P
€0.00 (tax incl.)
Synaptogyrin1 rt p29, syngr1
Reference: 104-2P
€0.00 (tax incl.)
Synaptobrevin2 rt VAMP 2, p18-2, Vamp2
Reference: 104-0P
€0.00 (tax incl.)
Synaptobrevin1 rt VAMP 1, p18-1, Vamp1
Reference: 119-2P
€0.00 (tax incl.)
SV2C rt SV2 C, SV2C
Reference: 119-1P
€0.00 (tax incl.)
SV2B rt SV2 B, SV2B
Reference: 119-0P
€0.00 (tax incl.)
SV2A hu SV2 A, SV2A
Reference: 27091-100
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
Reference: 27091-1
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
Reference: 268-1P
€0.00 (tax incl.)
SUMO1 ms SUMO 1, GMP-1, Setrin-1, SMT3C, SMT3H3, Sumo1, Gmp-1
Reference: 268-0P
€0.00 (tax incl.)
SUMO1 ms SUMO 1, GMP-1, Setrin-1, SMT3C, SMT3H3, Sumo1, Gmp-1
Reference: 10009266-1
€0.00 (tax incl.)
Peptide Sequence: human SREBP-2 protein amino acids 455-469 (SPLLDDAKVKDEPDS) · To be used in conjunction with Cayman’s SREBP-2 polyclonal antibody (Catalog No. 10007663) to block protein-antibody complex formation...
Reference: ep-1
€0.00 (tax incl.)
1 mg Spot-peptide.
Reference: ep-10
€0.00 (tax incl.)
10 mg Spot-peptide.
Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
Reference: 399-0P
€0.00 (tax incl.)
Spinophilin rt Neurabin II, Neurabin2
Reference: 10006823-1
€0.00 (tax incl.)
Peptide Sequence: human SPHK1 amino acids 264-274 (DLESEKYRRLG) · To be used in conjunction with Cayman’s Sphingosine Kinase 1 polyclonal antibody (Item No. 10006822) to block protein-antibody complex formation...
Reference: 392-0P
€0.00 (tax incl.)
SNX4 ms SNX 4, SNX4, Sorting nexin-4
Reference: 10005091-200
€0.00 (tax incl.)
Peptide Sequence: human SOAT-2/ACAT-2 amino acids 3-20 · To be used in conjunction with Cayman’s SOAT-2/ACAT-2 Polyclonal Antibody (Item No. 100027) to block protein-antibody complex formation during immunochemical...
Reference: 10005090-200
€0.00 (tax incl.)
Peptide Sequence: Human SOAT-1/ACAT-1 amino acids 6-23 · To be used in conjunction with Cayman’s SOAT-1/ACAT-1 Polyclonal Antibody (Item No. 100028) to block protein-antibody complex formation during immunochemical...
Reference: 148-1P
€0.00 (tax incl.)
Snapin rt Snapap, BLOC-1 subunit 7
Reference: 111-0P
€0.00 (tax incl.)
SNAP25 hu SNAP25, SUP
Reference: 111-2P
€0.00 (tax incl.)
SNAP23 hu Syndet, SNAP23
Reference: 430-0P
€0.00 (tax incl.)
SGT2 rt SGTb, SGT 2, SGTB, SGT beta
Reference: 10007682-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 28-37 · To be used in conjunction with Cayman’s sRBP4 Polyclonal Antibody (Catalog No. 10007681) to block protein-antibody complex formation during immunochemical analysis of sRBP4.
Reference: 10006620-1
€0.00 (tax incl.)
Peptide Sequence: human serine palmitoyltransferase subunit SPT2 amino acids 548-562 · To be used in conjunction with Cayman’s SPT polyclonal antibody (Catalog No. 10005260) to block protein-antibody complex...
Reference: 440-0P
€0.00 (tax incl.)
Septin11 rt SEPT11, Septin-11, Sept11, Septin 11
Reference: 422-0P
€0.00 (tax incl.)
SENP1 ms SENP1, SuPr-2, Sentrin-specific protease 1, SUMO-1 protease-2
Reference: 121-0P
€0.00 (tax incl.)
SCAMP1 rt SCAMP 1, SCAMP1
Reference: 124-3P
€0.00 (tax incl.)
SAP97 rt DLG 1, Disks large homolog 1, DLGH 1, SAP97, DLG1
Reference: 124-2P
€0.00 (tax incl.)
SAP102 rt DLG 3, Disks large homolog 3, DLGH 3, SAP102, DLG3
Reference: 294-4P
€0.00 (tax incl.)
SALM4 rt LRFN, LRFN 1, LRFN 3, LRFN 4, SALM 2, SALM 3, SALM 4
Reference: 294-3P
€0.00 (tax incl.)
Salm3 ms LRFN, LRFN 1, LRFN 3, LRFN 4, SALM 2, SALM 3, SALM 4
Reference: 294-2P
€0.00 (tax incl.)
SALM2 rt LRFN, LRFN 1, LRFN 3, LRFN 4, SALM 2, SALM 3, SALM 4
Reference: 10006616-1
€0.00 (tax incl.)
Peptide Sequence: human S1P1 protein amino acids 241-253 (ISKASRSSEKSLA) · To be used in conjunction with Cayman’s S1P1 polyclonal antibody (Catalog No. 10005228) to block protein-antibody complex formation during...
Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
Reference: 118-0P
€0.00 (tax incl.)
Rabphilin3a rt Exophilin 1, Rabphilin 3a, Rph3a
Reference: 320-0P
€0.00 (tax incl.)
Rab7a ms rab7
Reference: 10007073-1
€0.00 (tax incl.)
Peptide Sequence: human PTEN amino acids 254-270 · To be used in conjunction with Cayman’s PTEN polyclonal antibody (Catalog No. 10005059) to block protein-antibody complex formation during immunochemical analysis of...
Reference: 124-0P
€0.00 (tax incl.)
PSD95 rt SAP 90, DLG 4, Disks large homolog 4, DLGH 4, PSD95, SAP90, SAP 90
Reference: 124-1P
€0.00 (tax incl.)
PSD93 rt Chapsin 110, DLG 2, Disks large homolog 2, DLGH 2, PSD93
Reference: 10005388-200
€0.00 (tax incl.)
Peptide Sequence: human PGT amino acids 6-20 (KLGVSQGSDTSTSRA) · To be used in conjunction with Cayman’s PGT polyclonal antibody (Item No. 160200) to block protein-antibody complex formation during immunochemical...
Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Reference: 10005257-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s PGIS (mouse) Polyclonal Antibody (Item No. 100023) to block protein-antibody complex formation during immunochemical analysis of PGIS.
Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
Reference: 11188-5
€0.00 (tax incl.)
Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
Reference: 11188-25
€0.00 (tax incl.)
Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
Reference: 10006247-1
€0.00 (tax incl.)
Peptide Sequence: human PPAR.delta. amino acids 39-54 · To be used in conjunction with Cayman’s PPAR.delta. polyclonal antibody (Catalog No. 101720) to block protein-antibody complex formation during immunochemical...
Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
Reference: 10006284-1
€0.00 (tax incl.)
Peptide Sequence: human PINK1 amino acids 484-504 · To be used in conjunction with Cayman’s PINK1 polyclonal antibody (Catalog No. 10006283) to block protein-antibody complex formation during analysis for PINK1.
Reference: 10007475-1
€0.00 (tax incl.)
Peptide Sequence: PEPCK protein amino acids 5-17 · To be used in conjunction with Cayman’s PEPCK polyclonal antibody (Catalog No. 10004943) to block protein-antibody complex formation during immunochemical analysis...
Reference: 10009581-1
€0.00 (tax incl.)
Peptide Sequence: Mouse PCSK9 amino acids 152-163 (VFAQSIPWNLER) · To be used in conjunction with Cayman’s PCSK9 (mouse) Polyclonal Antibody (Item No. 10008811) to block protein-antibody complex formation during...
Reference: 10007186-1
€0.00 (tax incl.)
Peptide Sequence: human PCSK9 amino acids (SRSGKRRGERMEA) · To be used in conjunction with Cayman’s PCSK9 (human) polyclonal antibody (Catalog No. 10007185) to block protein-antibody complex formation during...
Reference: 354-0P
€0.00 (tax incl.)
Pantophysin ms Synaptophysin-like protein 1
Reference: 160604-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s PAF receptor polyclonal antiserum (Catalog No. 160602) to block protein-antibody complex formation during analysis for the PAF receptor.
Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...

Menu

Settings