Category: Peptides

Reference: HY-P3878
€0.00 (tax incl.)
Renin substrate 1 is a renin substrate with high affinity to the enzyme.
Reference: HY-P1314
€0.00 (tax incl.)
2-Furoyl-LIGRLO-amide is a potent and selective proteinase-activated receptor 2 (PAR2) agonist with a pD2 value of 7.0..
Reference: HY-P1449
€0.00 (tax incl.)
Boc-Gly-Gly-Phe-Gly-OH, a self-assembly of N- and C-protected tetrapeptide, is a protease cleavable linker used for the antibody-drug conjugate (ADC).
Reference: HY-P1076A
€0.00 (tax incl.)
CALP2 TFA is a calmodulin (CaM) antagonist (Kd of 7.9 µM) with high affinity for binding to the CaM EF-hand/Ca2+-binding site. CALP2 TFA inhibits CaM-dependent phosphodiesterase activity and increases intracellular...
Reference: HY-W013874
€0.00 (tax incl.)
Boc-D-3-Pal-OH is an alanine derivative.
Reference: HY-109538
€0.00 (tax incl.)
Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which...
Reference: HY-P4074
€0.00 (tax incl.)
Anti-BetaGamma, a peptide, is MPS-Phosducin-like protein C terminus.
Reference: HY-P1810
€0.00 (tax incl.)
c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm is a is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.25 and 0.05 nM for hV2R and rV2R, respectively.
Reference: HY-P1857
€0.00 (tax incl.)
CEF7, Influenza Virus NP (380-388) is a HLA-B*08 restricted influenza virus nucleoprotein epitope. Influenza virus NP functions as a key adapter molecule between virus and host cell processes.
Reference: HY-P3512
€0.00 (tax incl.)
Iseganan is an antimicrobial peptide, shows broad-spectrum anti-bacteria and fungi activity. Iseganan can be used in oral mucositis research.
Reference: HY-P1335
€0.00 (tax incl.)
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be...
Reference: HY-P0069A
€0.00 (tax incl.)
L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.
Reference: HY-P1021A
€0.00 (tax incl.)
Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.
Reference: HY-106377A
€0.00 (tax incl.)
BIO-11006 acetate, an analog of the MANS peptide, is a MARCKS (myristoylated alanine-rich C kinase substrate) inhibitor.
Reference: HY-P1474
€0.00 (tax incl.)
β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates...
Reference: HY-P1435A
€0.00 (tax incl.)
NoxA1ds TFA is a potent and selective NADPH oxidase 1 (NOX1) inhibitor (IC50=20 nM). NoxA1ds TFA exhibits selectivity for NOX1 over NOX2, NOX4, NOX5 and xanthine oxidase. NoxA1ds TFA inhibits NOX1-derived O2-...
Reference: HY-P3582A
€0.00 (tax incl.)
sGnRH-A acetate is a salmon gonadotropin-releasing hormone (GnRH) analogue. sGnRH-A acetate stimulates growth hormone secretion. sGnRH-A acetate also can be used as an inducer of ovulation by artificial insemination.
Reference: HY-13634A
€0.00 (tax incl.)
Ezatiostat (TER199 free base; TLK199) is a tripeptide analog of glutathione and is a selective and orally active glutathione S-transferase P1-1 (GSTP1) inhibitor. Ezatiostat leads to JNK activation by inhibiting...
Reference: HY-P1338A
€0.00 (tax incl.)
PL-017 TFA is a potent and selective μ opioid receptor agonist with an IC50 of 5.5 nM for 125I-FK 33,824 binding to μ site. PL-017 TFA produces long-lasting, reversible analgesia in rats.
Reference: HY-42709
€0.00 (tax incl.)
Z-Val-Ala-OH is a dipeptide derivative of valine and alanine.
Reference: HY-P3440
€0.00 (tax incl.)
WL12 is a specifically targeting programmed death ligand 1 (PD-L1) binding peptide. WL12 can be radiolabeled by different radionuclides, generating radiotracers, which can assess the tumor PD-L1 expression.
Reference: HY-W028991
€0.00 (tax incl.)
N-(4-Nitrobenzoyl)glycine is a Glycine (HY-Y0966) derivative.
Reference: HY-P3861
€0.00 (tax incl.)
Biotin-NeurokininA is a biotinylated NeurokininA (HY-P0197). Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human...
Reference: HY-P3580
€0.00 (tax incl.)
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory...
Reference: HY-P1310
€0.00 (tax incl.)
VKGILS-NH2 is a reversed amino acid sequence control peptide for SLIGKV-NH2 (protease-activated receptor 2 (PAR2) agonist). VKGILS-NH2 has no effect on DNA synthesis in cells.
Reference: HY-P1530
€0.00 (tax incl.)
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.
Reference: HY-P1292A
€0.00 (tax incl.)
PKG inhibitor peptide TFA is an ATP-competitive inhibitor of cGMP-dependent protein kinase (PKG), with a Ki of 86 μM.
Reference: HY-P1268A
€0.00 (tax incl.)
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and...
Reference: HY-W016330
€0.00 (tax incl.)
H-His(1-Me)-OMe is a histidine derivative that can be used for amino acid synthesis.
Reference: HY-P1489A
€0.00 (tax incl.)
OVA Peptide(257-264) TFA is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
Reference: HY-P2496
€0.00 (tax incl.)
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin...
Reference: HY-P1239
€0.00 (tax incl.)
Neuromedin S(rat) is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1
Reference: HY-P4242
€0.00 (tax incl.)
Ala-Gly-Ala is a prototype of a general tripeptide Xxx-Gly-Zzz. Except glycine and proline, there can be 18 possible amino acids for Xxx and another 18 amino acids for Zzz. Ala-Gly-Ala can be used as a model for up to...
Reference: HY-P1846
€0.00 (tax incl.)
Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of...
Reference: HY-P3972
€0.00 (tax incl.)
H-ILE-ARG-VAL-VAL-MET-OH is a pentapeptide from C7 with a domain that supports cell attachment. H-ILE-ARG-VAL-VAL-MET-OH is also the sequence fragment that binds to the thrombospondin-1 (TS1) receptor.
Reference: HY-P3401
€0.00 (tax incl.)
GHGVYGHGVYGHGPYGHGPYGHGLYW (DgHBP-2) is 26-amino-acid-long consensus peptide derived from histidine-rich beak protein-2 (DgHBP-2). GHGVYGHGVYGHGPYGHGPYGHGLYW can be used fabricated glucose-responsive insulin delivery...
Reference: HY-75332
€0.00 (tax incl.)
Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively.
Reference: HY-P2542
€0.00 (tax incl.)
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Reference: HY-P3598
€0.00 (tax incl.)
Substance P(1-4) is a potent neurokinin receptors (NK-R) antagonist. Substance P(1-4) has regulation of normal hematopoiesis and inhibits endogenous erythroid colony (EEC) formation.
Reference: HY-P3142
€0.00 (tax incl.)
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Reference: HY-P2463
€0.00 (tax incl.)
Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing.
Reference: HY-P3568
€0.00 (tax incl.)
Adipokinetic hormone Gryllus bimaculatus (Grybi-AKH) is an adipokinetic hormone that regulates energy homeostasis in insects by mobilizing lipid and carbohydrate from the fat body. Adipokinetic hormone Gryllus...
Reference: HY-W013968
€0.00 (tax incl.)
Boc-Gly-Gly-OH is a Glycine (HY-Y0966) derivative.
Reference: HY-P2497
€0.00 (tax incl.)
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
Reference: HY-P3645
€0.00 (tax incl.)
(Nle4)-α-MSH is a synthetic analogue of α-MSH (HY-P0252), a melanocyte-stimulating hormone. (Nle4)-α-MSH reversibly darkens frog skins and also exhibits prolonged activity after heat-alkali treatment.
Reference: HY-12290
€0.00 (tax incl.)
Arg-Gly-Asp-Ser is an integrin binding sequence that inhibits integrin receptor function. Arg-Gly-Asp-Ser directly and specifically bind pro-caspase-8, pro-caspase-9 and pro-caspase-3, while it does not bind...
Reference: HY-P1613
€0.00 (tax incl.)
Cyclo(Arg-Gly-Asp-D-Phe-Val) is an integrin αvβ3 inhibitor. Cyclo(Arg-Gly-Asp-D-Phe-Val) has antitumor activity. Cyclo(Arg-Gly-Asp-D-Phe-Val) can be used for the research of acute myeloid leukemia.
Reference: HY-P3557
€0.00 (tax incl.)
Mibenratide, a small cyclic peptide, is an adrenergic β1 receptor antagonist. Mibenratide can be used for heart failure research.
Reference: HY-P1869
€0.00 (tax incl.)
Neuropeptide EI, rat displays functional melanin concentrating hormone (MCH)-antagonist and melanocyte-stimulating hormone (MSH) agonist activity in different behavioral paradigms.
Reference: HY-W012713
€0.00 (tax incl.)
Ac-D-Ala-OH is an alanine derivative.
Reference: HY-P3911
€0.00 (tax incl.)
CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein.
Reference: HY-P1260
€0.00 (tax incl.)
FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor.
Reference: HY-P1624
€0.00 (tax incl.)
Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel...
Reference: HY-P3845
€0.00 (tax incl.)
(Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22...
Reference: HY-W011200
€0.00 (tax incl.)
H-Gly-OBzl.TosOH is a Glycine (HY-Y0966) derivative.
Reference: HY-W065053
€0.00 (tax incl.)
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative.
Reference: HY-P2004
€0.00 (tax incl.)
FFAGLDD is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.
Reference: HY-W013659
€0.00 (tax incl.)
Fmoc-Asp(OcHex)-OH is an aspartic acid derivative.
Reference: HY-P1294A
€0.00 (tax incl.)
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM.
Reference: HY-W007842
€0.00 (tax incl.)
Z-Ser-OH is a serine derivative.
Reference: HY-P3523
€0.00 (tax incl.)
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.
Reference: HY-W041983
€0.00 (tax incl.)
Fmoc-Cpa-OH is a compound containing both an amino group and a carboxyl group.
Reference: HY-105037
€0.00 (tax incl.)
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy....
Reference: HY-P3866
€0.00 (tax incl.)
[Asu1,6]-Oxytocin is an analog of oxytocin. [Asu1,6]-Oxytocin reverses insulin resistance and glucose intolerance prior to reduction of obesity. [Asu1,6]-Oxytocin has the potential for the research of obesity and...
Reference: HY-P4027
€0.00 (tax incl.)
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the...
Reference: HY-P1186
€0.00 (tax incl.)
Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
Reference: HY-105239
€0.00 (tax incl.)
Selepressin (FE 202158) is a selective vasopressin V1A receptor agonist. Selepressin is a potent vasopressor. Selepressin can be used in the research of septic shock.
Reference: HY-W008016
€0.00 (tax incl.)
Fmoc-Tyr(tBu)-OH is a tyrosine derivative.
Reference: HY-P3414
€0.00 (tax incl.)
Proteasome-activating peptide 1 is a peptide, which increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1...
Reference: HY-P1475
€0.00 (tax incl.)
C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with insulin.
Reference: HY-P1567
€0.00 (tax incl.)
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
Reference: HY-W019676
€0.00 (tax incl.)
Boc-Tyr-OtBu is a tyrosine derivative.
Reference: HY-P3944
€0.00 (tax incl.)
Calmodulin Dependent Protein Kinase Substrate is a Ca2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for...
Reference: HY-P1573A
€0.00 (tax incl.)
Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
Reference: HY-P3705
€0.00 (tax incl.)
VIHS is a 4 amino acid peptide.
Reference: HY-P1050
€0.00 (tax incl.)
COG 133 is a fragment of Apolipoprotein E (APOE) peptide. COG 133 competes with the ApoE holoprotein for binding the LDL receptor, with potent anti-inflammatory and neuroprotective effects. COG 133 is also a nAChR...
Reference: HY-P2253
€0.00 (tax incl.)
H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).

Menu

Settings