Category: Peptides

Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).
Reference: 321-0P
€0.00 (tax incl.)
VPS18 ms PEP 3, VPS 18, VPS18
Reference: 135-0P
€0.00 (tax incl.)
VGLUT1 rt BNPI, SLC17A7, VGLUT1
Reference: 131-0P
€0.00 (tax incl.)
VGAT rt VIAAT, SLC32A1
Reference: 279-0P
€0.00 (tax incl.)
VDAC1 ms Porin, VDAC 1
Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
Reference: 337-0P
€0.00 (tax incl.)
TorsinA hu DYT 1, Torsin 1A, Tor1a, Dyt1
Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Reference: 458-0P
€0.00 (tax incl.)
Tecpr1 rt Tectonin beta-propeller repeat-containing protein 1
Reference: 110-1BP
€0.00 (tax incl.)
Syntaxin1B rt p35, Syntaxin 1A, Syntaxin 1B, stx 1, stx 1A, stx 1B, stx1, p35B
Reference: 157-0P
€0.00 (tax incl.)
SynGAP rt p135 SynGAP, Neuronal RasGAP
Reference: 243-4P
€0.00 (tax incl.)
SynCAM4 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2, Cell adhesion molecule 4
Reference: 243-3P
€0.00 (tax incl.)
SynCAM3 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2
Reference: 243-2P
€0.00 (tax incl.)
SynCAM2 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2
Reference: 243-0P
€0.00 (tax incl.)
SynCAM1 ms Cadm, Necl, IgSF4, SynCAM 2, SynCAM 3, SynCAM 4, Cadm2, Cadm 2
Reference: 102-0P
€0.00 (tax incl.)
Synaptoporin rt Synaptophysin 2, p38-2
Reference: 102-1P
€0.00 (tax incl.)
Synaptoporin rt Synaptophysin 2, p38-2
Reference: 101-0P
€0.00 (tax incl.)
Synaptophysin1 hu p38-1, Synaptophysin1
Reference: 145-1P
€0.00 (tax incl.)
Synaptojanin1 rt Synj1
Reference: 145-0P
€0.00 (tax incl.)
Synaptojanin1 rt Synj1
Reference: 103-02P
€0.00 (tax incl.)
Synaptogyrin2 rt Cellugyrin, Syngr2
Reference: 103-0P
€0.00 (tax incl.)
Synaptogyrin1 rt p29, syngr1
Reference: 104-2P
€0.00 (tax incl.)
Synaptobrevin2 rt VAMP 2, p18-2, Vamp2
Reference: 104-0P
€0.00 (tax incl.)
Synaptobrevin1 rt VAMP 1, p18-1, Vamp1
Reference: 119-2P
€0.00 (tax incl.)
SV2C rt SV2 C, SV2C
Reference: 119-1P
€0.00 (tax incl.)
SV2B rt SV2 B, SV2B
Reference: 119-0P
€0.00 (tax incl.)
SV2A hu SV2 A, SV2A
Reference: 268-1P
€0.00 (tax incl.)
SUMO1 ms SUMO 1, GMP-1, Setrin-1, SMT3C, SMT3H3, Sumo1, Gmp-1
Reference: 268-0P
€0.00 (tax incl.)
SUMO1 ms SUMO 1, GMP-1, Setrin-1, SMT3C, SMT3H3, Sumo1, Gmp-1
Reference: 399-0P
€0.00 (tax incl.)
Spinophilin rt Neurabin II, Neurabin2
Reference: 392-0P
€0.00 (tax incl.)
SNX4 ms SNX 4, SNX4, Sorting nexin-4
Reference: 148-1P
€0.00 (tax incl.)
Snapin rt Snapap, BLOC-1 subunit 7
Reference: 111-0P
€0.00 (tax incl.)
SNAP25 hu SNAP25, SUP
Reference: 111-2P
€0.00 (tax incl.)
SNAP23 hu Syndet, SNAP23
Reference: 430-0P
€0.00 (tax incl.)
SGT2 rt SGTb, SGT 2, SGTB, SGT beta
Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
Reference: 440-0P
€0.00 (tax incl.)
Septin11 rt SEPT11, Septin-11, Sept11, Septin 11
Reference: 422-0P
€0.00 (tax incl.)
SENP1 ms SENP1, SuPr-2, Sentrin-specific protease 1, SUMO-1 protease-2
Reference: 121-0P
€0.00 (tax incl.)
SCAMP1 rt SCAMP 1, SCAMP1
Reference: 124-3P
€0.00 (tax incl.)
SAP97 rt DLG 1, Disks large homolog 1, DLGH 1, SAP97, DLG1
Reference: 124-2P
€0.00 (tax incl.)
SAP102 rt DLG 3, Disks large homolog 3, DLGH 3, SAP102, DLG3
Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
Reference: 294-4P
€0.00 (tax incl.)
SALM4 rt LRFN, LRFN 1, LRFN 3, LRFN 4, SALM 2, SALM 3, SALM 4
Reference: 294-3P
€0.00 (tax incl.)
Salm3 ms LRFN, LRFN 1, LRFN 3, LRFN 4, SALM 2, SALM 3, SALM 4
Reference: 294-2P
€0.00 (tax incl.)
SALM2 rt LRFN, LRFN 1, LRFN 3, LRFN 4, SALM 2, SALM 3, SALM 4
Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
Reference: 118-0P
€0.00 (tax incl.)
Rabphilin3a rt Exophilin 1, Rabphilin 3a, Rph3a
Reference: 320-0P
€0.00 (tax incl.)
Rab7a ms rab7
Reference: 124-0P
€0.00 (tax incl.)
PSD95 rt SAP 90, DLG 4, Disks large homolog 4, DLGH 4, PSD95, SAP90, SAP 90
Reference: 124-1P
€0.00 (tax incl.)
PSD93 rt Chapsin 110, DLG 2, Disks large homolog 2, DLGH 2, PSD93
Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
Reference: 354-0P
€0.00 (tax incl.)
Pantophysin ms Synaptophysin-like protein 1
Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
Reference: 374-0P
€0.00 (tax incl.)
Numbl ms Numbl, Nbl, Numb-like
Reference: 373-0P
€0.00 (tax incl.)
Numb ms Nb, Protein numb homolog

NSF

Reference: 123-0P
€0.00 (tax incl.)
NSF rt Vesicle-fusing ATPase, NEM-sensitive fusion protein, SKD2
Reference: 129-4P
€0.00 (tax incl.)
Neuroligin4 ms Neuroligin4, Nlgn4
Reference: 129-3P
€0.00 (tax incl.)
Neuroligin3 ms Neuroligin 3, Nlgn3
Reference: 129-2P
€0.00 (tax incl.)
Neuroligin2 rt Neuroligin2, Nlgn2
Reference: 453-0P
€0.00 (tax incl.)
Neurocan ms Neurocan core protein, Chondroitin sulfate proteoglycan 3, Ncan, Cspg3

NET

Reference: 260-0P
€0.00 (tax incl.)
NET rt SLC6A2
Reference: 116-2P
€0.00 (tax incl.)
Munc18-3 rt rb-Sec1, n-Sec1, p67, stxbp2, stxbp1, Munc 18-1, Munc 18-2, Munc 18-3, Munc18
Reference: 116-0P
€0.00 (tax incl.)
Munc18-1 rt rb-Sec1, n-Sec1, p67, stxbp2, stxbp1, Munc 18-1, Munc 18-2, Munc 18-3, Munc18
Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Reference: 310-2P
€0.00 (tax incl.)
MLC-2V hu Myosin
Reference: 310-1P
€0.00 (tax incl.)
MLC-2V ms Myosin
Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
Reference: 191-1P
€0.00 (tax incl.)
mGluR2 rt mGluR 1, mGluR 2
Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Reference: 229-0P
€0.00 (tax incl.)
MAL2A rt T-cell diff. protein 2, MAL2A, T-cell differentiation protein 2, MAL2
Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
Reference: L15-58
€0.00 (tax incl.)
The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.
Reference: 368-0P
€0.00 (tax incl.)
Kv7.3 rt Potassium channel, KCNQ3, KCNQ2, Kv7.2, Kv7.3
Reference: 368-1P
€0.00 (tax incl.)
Kv7.2 ms Potassium channel, KCNQ3, KCNQ2, Kv7.2, Kv7.3
Reference: 242-0P
€0.00 (tax incl.)
Kv3.1b ms KCNC1, Potassium channel, Kv3.1b, Kcnc 1
Reference: 231-1P
€0.00 (tax incl.)
Kv2.2 rat Potassium channel, DRK, KCNB, CDRK, Kv2.2, Kv2.1, Kcnb2
Reference: J03-58-1000
€0.00 (tax incl.)
The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.
Reference: I40-58-1000
€0.00 (tax incl.)
The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.
Reference: 117-0P
€0.00 (tax incl.)
IP3-receptortype1 rt InsP3, IP3R1, PCD-6
Reference: I33-58
€0.00 (tax incl.)
The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.

Menu

Settings