Peptides

11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide

Reference: 10005729-1

€0.00 (tax incl.)

Peptide Sequence: human 11β-HSD1 amino acids 78-92 (CLELGAASAHYLAGT) · To be used in conjunction with Cayman’s 11β-HSD1 polyclonal antibody (Catalog No. 10004303) to block protein-antibody complex formation during...

11β-Hydroxysteroid Dehydrogenase (Type 2) Blocking Peptide

Reference: 10242-200

€0.00 (tax incl.)

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200

€0.00 (tax incl.)

Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...

15-Lipoxygenase-2 Blocking Peptide

Reference: 10004457-200

€0.00 (tax incl.)

Immunogen: Synthetic peptide from the internal region of 15-LO-2 · To be used in conjunction with Cayman’s 15-LO-2 polyclonal antibody (Catalog No. 10004454) to block protein-antibody complex formation during...

27-alkyne Cholesterol

Reference: 24319-500

€0.00 (tax incl.)

An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization

27-alkyne Cholesterol

Reference: 24319-250

€0.00 (tax incl.)

An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization

27-alkyne Cholesterol

Reference: 24319-100

€0.00 (tax incl.)

An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization

5-FAM-Amyloid-β (1-28) Peptide (human) (trifluoroacetate salt)

Reference: 27108-100

€0.00 (tax incl.)

A fluorescently labeled amyloid-β peptide; ex/em = 492/518 nm

5-FAM-Amyloid-β (1-42) Peptide (human) (trifluoroacetate salt)

Reference: 27408-500

€0.00 (tax incl.)

A fluorescently labeled amyloid-β peptide; ex/em = 492/518 nm

5-Lipoxygenase Blocking Peptide

Reference: 360402-200

€0.00 (tax incl.)

Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...

5-OxoETE Receptor Blocking Peptide

Reference: 10006618-1

€0.00 (tax incl.)

Peptide Sequence: human 5-OxoETE receptor C-terminal amino acids 408-423 (KVQGEVSLEKEGSSQG) · To be used in conjunction with Cayman’s 5-OxoETE Receptor polyclonal antibody (Catalog No. 100025) to block...

Abltide

Reference: A02-58-1000

€0.00 (tax incl.)

The Abltide peptide sequence (EAIYAAPFAKKK) is based on the C-terminus of Abl.

Acetylated Histone H3 Peptide I

Reference: H12-358-500

€0.00 (tax incl.)

The Acetylated Histone H3 (K9, 14) Peptide sequence (ARTKQTAR[Ac-K]STGG[Ac-K]APRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the assay control of histone (de-)methylation and (de-)...

Acetylated Histone H4 Peptide I

Reference: H13-358-500

€0.00 (tax incl.)

The Acetylated Histone H4 (K5, 8, 12, 16) Peptide sequence (SGRG[Ac-K]GG[Ac-K]GLG[Ac-K]GGA[Ac-K]RHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the assay control of histone...

Acridinium NHS ester

Reference: 200200-50

€0.00 (tax incl.)

The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...

Acridinium NHS ester

Reference: 200200-5

€0.00 (tax incl.)

The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...

Acridinium NHS ester

Reference: 200200-10

€0.00 (tax incl.)

The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...

Acridinium NHS ester

Reference: 200200-1

€0.00 (tax incl.)

The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...

Adenosine Receptor A2A Blocking Peptide

Reference: 10092-200

€0.00 (tax incl.)

Adipose Triglyceride Lipase Blocking Peptide

Reference: 10008492-1

€0.00 (tax incl.)

Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) · To be used in conjunction with Cayman’s Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block...

AdPLA2 Blocking Peptide

Reference: 10338-200

€0.00 (tax incl.)

AiF

Reference: 300-0P

€0.00 (tax incl.)

AiF ms PDCD8, PDCD 8

AIF Blocking Peptide

Reference: 360773-1

€0.00 (tax incl.)

Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...

Aldh1L1

Reference: 278-0P

€0.00 (tax incl.)

Aldh1L1 rt FDH, FDN

alpha-Tubulin

Reference: 302-21P

€0.00 (tax incl.)

alpha-tubulin 4A hu Delta2-Tubulin, Glu-alpha-Tubulin, Tyr-alpha-Tubulin, TUBA1, alpha-Tubulin

AMARA Peptide

Reference: A11-58

€0.00 (tax incl.)

The AMARA substrate peptide sequence (AMARAASAAALARRR) is routinely evaluated as a substrate for SIK and AMPK.

Amphiphysin

Reference: 120-0P

€0.00 (tax incl.)

Amphiphysin rt AMPH

AP 180

Reference: 155-0P

€0.00 (tax incl.)

AP180 rt pp155, NP185, F1-20, SNAP 91, AP 3, AP180, SNAP91

Apaf-1 Blocking Peptide

Reference: 360780-200

€0.00 (tax incl.)

Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...

ApoA1 Blocking Peptide

Reference: 13079-200

€0.00 (tax incl.)

APP

Reference: 127-0P

€0.00 (tax incl.)

APP rt amyloid precursor protein

ASPEP

Reference: 296-0P

€0.00 (tax incl.)

ASPEP ms DNPEP, DAP, Aspartyl Aminopeptidase

ATP1B2

Reference: 407-0P

€0.00 (tax incl.)

ATP1B2 ms AMOG, ATP1B2

Autocamtide 2

Reference: A15-58

€0.00 (tax incl.)

The Autocamtide 2 peptide sequence (KKALRRQETVDAL-amide) is based on the autophosphorylation site (amino acid 283-290) on CaMKII.

Axltide

Reference: A16-58

€0.00 (tax incl.)

The Axltide peptide sequence (KKSRGDYMTMQIG) is based on the mouse Insulin receptor substrate 1 (amino acid 979-989).

beta SNAP

Reference: 112-2P

€0.00 (tax incl.)

beta SNAP ms Beta-soluble NSF attachment protein

beta-Catenin

Reference: 281-0P

€0.00 (tax incl.)

beta-Catenin ms CTNNB1, beta-Catenin, Catenin alpha-2, Catnb, CTNNB 1

beta1-Integrin

Reference: 240-0P

€0.00 (tax incl.)

beta1-Integrin ms Integrins, VLA, CD 29, CD 61, CD29, CD61, Itgb3

beta3-Integrin

Reference: 240-3P

€0.00 (tax incl.)

beta3-Integrin ms Integrins, VLA, CD 29, CD 61, CD29, CD61, Itgb3

beta3-Tubulin

Reference: 302-3P

€0.00 (tax incl.)

beta3-Tubulin ms TuJ1, TUBB3

Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Reference: 27411-500

€0.00 (tax incl.)

An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,

Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt)

Reference: 27410-500

€0.00 (tax incl.)

An affinity probe for Aβ42 binding partners; has been used to identify Aβ42 interaction partners in rat hippocampal synaptosomal membranes

Biotin-Amyloid-β (1-42) Peptide (trifluoroacetate salt)

Reference: 27410-100

€0.00 (tax incl.)

An affinity probe for Aβ42 binding partners; has been used to identify Aβ42 interaction partners in rat hippocampal synaptosomal membranes

BLT1 Receptor Blocking Peptide

Reference: 120112-200

€0.00 (tax incl.)

Peptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...

BLT2 Receptor Blocking Peptide

Reference: 320124-200

€0.00 (tax incl.)

Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...

BODIPY 630/650X succinimide ester

Reference: 27758-5

€0.00 (tax incl.)

An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively

BODIPY 630/650X succinimide ester

Reference: 27758-1

€0.00 (tax incl.)

An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively

BODIPY-Cholesterol

Reference: 24618-500

€0.00 (tax incl.)

A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...

BODIPY-Cholesterol

Reference: 24618-5

€0.00 (tax incl.)

A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...

BODIPY-Cholesterol

Reference: 24618-10

€0.00 (tax incl.)

A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...

BODIPY-Cholesterol

Reference: 24618-1

€0.00 (tax incl.)

A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...

c-Fos

Reference: 226-0P

€0.00 (tax incl.)

c-Fos rt v-Fos

Calmodulin

Reference: 301-0P

€0.00 (tax incl.)

Calmodulin rt CaM

CASKIN 1

Reference: 185-0P

€0.00 (tax incl.)

CASKIN1 rt

Caspase-3 (human) Blocking Peptide

Reference: 360745-200

€0.00 (tax incl.)

Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...

CATCHtide

Reference: C02-58

€0.00 (tax incl.)

The CATCHtide peptide sequence (CRRHYYYDTHTNTYY-LRTFGHNTRR) is derived from human SLC12A2 (amino acids 198-217) and is suitable as a substrate for kinases OSR1 and STK39.

Caveolin 1

Reference: 161-0P

€0.00 (tax incl.)

Caveolin1 rt Caveolin 1, Cav1

Caveolin 1/3 Blocking Peptide

Reference: 300830-200

€0.00 (tax incl.)

Peptide Sequence: rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF)(3942) · To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex...

CB1 Receptor (C-Term) Blocking Peptide

Reference: 10006591-1

€0.00 (tax incl.)

Peptide Sequence: CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 Receptor (C-Term) polyclonal antibody (Item No. 10006590) to block protein-antibody complex formation during...

CB2 Receptor Blocking Peptide

Reference: 301550-200

€0.00 (tax incl.)

Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...

CD36 Blocking Peptide

Reference: 300011-1

€0.00 (tax incl.)

Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...

CDKtide

Reference: C06-58

€0.00 (tax incl.)

The CDKtide peptide sequence (CKKKYSPTSPSYSPTSPSY-SPTSPS) is derived from the C-terminus of the largest subunit of human RNA polymerase II which has 52 approximate tandem repeats of 7 amino acids...

Cellubrevin

Reference: 104-1P

€0.00 (tax incl.)

Cellubrevin rt VAMP 3, Synaptobrevin 3, Vamp 3, Vamp3, CEB

Cellular Retinol Binding Protein 7 Blocking Peptide

Reference: 10010251-1

€0.00 (tax incl.)

Peptide Sequence: synthetic peptide from human cRBP7 amino acids 125-134 (QVCKQTFQRA) · To be used in conjunction with Cayman’s Cellular Retinol Binding Protein 7 polyclonal antibody (Catalog No. 10010251) to block...

Chemokine-Like Receptor 1 Blocking Peptide

Reference: 10326-200

€0.00 (tax incl.)

Chil3 / YM1

Reference: 442-0P

€0.00 (tax incl.)

Chil3 ms Chitinase-like protein 3, Beta-N-acetylhexosaminidase Ym1, ECF-L, Chitinase-3-like protein 3, Eosinophil chemotactic cytokine, Secreted protein Ym1, Chi3l3, Ym1

Chktide

Reference: C10-58

€0.00 (tax incl.)

The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).

ChREBP Blocking Peptide

Reference: 10006790-1

€0.00 (tax incl.)

Peptide Sequence: murine amino acids 715-735 · To be used in conjunction with Cayman’s ChREBP polyclonal antibody (Catalog No. 10006789) to block protein-antibody complex formation during immunochemical analysis of...

CK1tide

Reference: C07-58-1

€0.00 (tax incl.)

The CK1tide synthetic peptide [HAAIGDDDDAYSITA-NH2] is routinely evaluated as a substrate for CK1 family kinases, such as CK1 and CK1 delta.

Clathrin light chain

Reference: 113-0P

€0.00 (tax incl.)

Clathrin light chainB rt Lcb, Cltb

Claudin 11

Reference: 241-0P

€0.00 (tax incl.)

Claudin11 rt OSP, claudin11, Otm, Cldn11, OPS, Oligodendrocyte-specific protein

CNIH 2

Reference: 253-2P

€0.00 (tax incl.)

CNIH2 ms Cornichon, CNIH 2, CNIH 3, CNIH2, CNIH3, Cornichon 2

Complexin 1/2

Reference: 122-0P

€0.00 (tax incl.)

Complexin2 hu Synaphin 1, Synaphin 2, CPX 1, CPX 2, Complexin 1, Complexin 2, Complexin I, Complexin II, CPX I, CPX II, CPX1, CPX2, Cplx1, 2

COX 4

Reference: 298-0P

€0.00 (tax incl.)

COX4 ms COX, COX IV, Cox4, Cox IV-1

COX-1 (mouse) Blocking Peptide

Reference: 360109-200

€0.00 (tax incl.)

Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...

COX-1 (ovine) Blocking Peptide

Reference: 360108-200

€0.00 (tax incl.)

Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...

COX-2 (human) Blocking Peptide

Reference: 360107-200

€0.00 (tax incl.)

Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...

COX-2 (mouse) Blocking Peptide

Reference: 360106-200

€0.00 (tax incl.)

Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...

CPT1c

Reference: 415-0P

€0.00 (tax incl.)

Cpt1c ms CPT1c, CPTI-B

CREBtide

Reference: C50-58

€0.00 (tax incl.)

The CREBtide peptide sequence (KRREILSRRPSYR) is based on the human CREB1 isoform A (amino acid 109-121).

Crosstide

Reference: C51-58

€0.00 (tax incl.)

The Crosstide peptide sequence (GRPRTSSFAEG) is based on the GSK3.

CRTH2/DP2 Receptor (C-Term) Blocking Peptide

Reference: 10007003-1

€0.00 (tax incl.)

Peptide Sequence: CRTH2/DP2 protein amino acids 378-395 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (C-Term) polyclonal antibody (Catalog No. 10007002) to block protein-antibody complex formation...

CRTH2/DP2 Receptor (N-Term) Blocking Peptide

Reference: 10004884-200

€0.00 (tax incl.)

Peptide Sequence: CRTH2/DP2 protein amino acids 2-21 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (N-Term) polyclonal antibody (Item No. 10004886) to block protein-antibody complex formation during...

CSKtide

Reference: C63-58

€0.00 (tax incl.)

The synthetic peptide CSKtide (KKKEEIYFFFG-NH2) contains a tyrosine protein kinase phosphorylation site and can be used for CSK and TNK1 assay.

CtBP 1

Reference: 222-0P

€0.00 (tax incl.)

CtBP1 rt BARS, CtBP1

CysLT1 Receptor Blocking Peptide

Reference: 320500-200

€0.00 (tax incl.)

Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...

CysLT2 Receptor (C-Term) Blocking Peptide

Reference: 320550-1

€0.00 (tax incl.)

Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...

CysLT2 Receptor (N-Term) Blocking Peptide

Reference: 320560-200

€0.00 (tax incl.)

Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...

DARPP 32

Reference: 382-0P

€0.00 (tax incl.)

Darpp32 ms PPP1R1B, DARPP32, DARPP-32, Dopamine- and cAMP-regulated neuronal phosphoprotein, Ppp1r1b

Doppel Blocking Peptide

Reference: 10005516-200

€0.00 (tax incl.)

Peptide Sequence: human doppel protein amino acids 112-120 (ATQAANQGE) · To be used in conjunction with Cayman’s Doppel polyclonal antibody (Catalog No. 10005517) to block protein-antibody complex formation during...

DP1 Receptor Blocking Peptide

Reference: 301640-1

€0.00 (tax incl.)

To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.

Dynamin 1/2/3

Reference: 115-0P

€0.00 (tax incl.)

Dynamin1 rt dynamin 1, dynamin 2, dynamin 3

Dynamin 3

Reference: 115-3P

€0.00 (tax incl.)

Dynamin3 ms dynamin 1, dynamin 2, dynamin 3

DYRKtide

Reference: D96-58

€0.00 (tax incl.)

The synthetic peptide (RRRFRPASPLRGPPK) contains a serine/threonine protein kinase phosphorylation site and is routinely evaluated as a substrate for DYRK family kinases.