Category: Peptides

Reference: 374-0P
€0.00 (tax incl.)
Numbl ms Numbl, Nbl, Numb-like
Reference: 373-0P
€0.00 (tax incl.)
Numb ms Nb, Protein numb homolog

NSF

Reference: 123-0P
€0.00 (tax incl.)
NSF rt Vesicle-fusing ATPase, NEM-sensitive fusion protein, SKD2
Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
Reference: 129-4P
€0.00 (tax incl.)
Neuroligin4 ms Neuroligin4, Nlgn4
Reference: 129-3P
€0.00 (tax incl.)
Neuroligin3 ms Neuroligin 3, Nlgn3
Reference: 129-2P
€0.00 (tax incl.)
Neuroligin2 rt Neuroligin2, Nlgn2
Reference: 453-0P
€0.00 (tax incl.)
Neurocan ms Neurocan core protein, Chondroitin sulfate proteoglycan 3, Ncan, Cspg3

NET

Reference: 260-0P
€0.00 (tax incl.)
NET rt SLC6A2
Reference: 27183-50
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
Reference: 27183-5
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
Reference: 27183-10
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
Reference: 11189-5
€0.00 (tax incl.)
Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant. N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
Reference: 11189-25
€0.00 (tax incl.)
Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant. N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
Reference: 116-2P
€0.00 (tax incl.)
Munc18-3 rt rb-Sec1, n-Sec1, p67, stxbp2, stxbp1, Munc 18-1, Munc 18-2, Munc 18-3, Munc18
Reference: 116-0P
€0.00 (tax incl.)
Munc18-1 rt rb-Sec1, n-Sec1, p67, stxbp2, stxbp1, Munc 18-1, Munc 18-2, Munc 18-3, Munc18
Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
Reference: 310-2P
€0.00 (tax incl.)
MLC-2V hu Myosin
Reference: 310-1P
€0.00 (tax incl.)
MLC-2V ms Myosin
Reference: 191-1P
€0.00 (tax incl.)
mGluR2 rt mGluR 1, mGluR 2
Reference: 10006356-1
€0.00 (tax incl.)
Peptide Sequence: mouse melanocortin-4 (MC4R) receptor amino acids 21-33 (YGLHSNASESLGK) · To be used in conjunction with Cayman’s MC4R polyclonal antibody (Catalog No. 10006355) to block protein-antibody complex...
Reference: 229-0P
€0.00 (tax incl.)
MAL2A rt T-cell diff. protein 2, MAL2A, T-cell differentiation protein 2, MAL2
Reference: 10007193-1
€0.00 (tax incl.)
Peptide Sequence: rat lysoPLD amino acids 573-588 · To be used in conjunction with Cayman’s lysoPLD polyclonal antibody (Catalog No. 10005375) to block protein-antibody complex formation during immunochemical...
Reference: 10005092-200
€0.00 (tax incl.)
Peptide Sequence: murine amino acids 1-12 (MNECHYDKRMDF) · To be used in conjunction with Cayman’s LPA3 polyclonal antibody (Item No. 10004840) to block protein-antibody complex formation during immunochemical...
Reference: 10006984-1
€0.00 (tax incl.)
Peptide Sequence: human LPA1 amino acids 342-359 · To be used in conjunction with Cayman’s LPA1 polyclonal antibody (Catalog No. 10005280) to block protein-antibody complex formation during immunochemical analysis of...
Reference: 10007672-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s NPC1L1 Polyclonal Antibody (Item No. 100076655) to block protein-antibody complex formation during immunochemical analysis of NPC1L1
Reference: 10009324-1
€0.00 (tax incl.)
Amino acids: Human LCAT protein amino acids 132-143 · To be used in conjunction with Cayman’s LCAT Polyclonal Antibody (Item No. 10009323) to block protein-antibody complex formation during immunochemical analysis of...
Reference: 368-0P
€0.00 (tax incl.)
Kv7.3 rt Potassium channel, KCNQ3, KCNQ2, Kv7.2, Kv7.3
Reference: 368-1P
€0.00 (tax incl.)
Kv7.2 ms Potassium channel, KCNQ3, KCNQ2, Kv7.2, Kv7.3
Reference: 242-0P
€0.00 (tax incl.)
Kv3.1b ms KCNC1, Potassium channel, Kv3.1b, Kcnc 1
Reference: 231-1P
€0.00 (tax incl.)
Kv2.2 rat Potassium channel, DRK, KCNB, CDRK, Kv2.2, Kv2.1, Kcnb2
Reference: 117-0P
€0.00 (tax incl.)
IP3-receptortype1 rt InsP3, IP3R1, PCD-6
Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
Reference: 10005519-200
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (human) polyclonal antibody (Catalog No. 10005518) to block protein-antibody complex formation during...
Reference: 10008206-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 192-206 · To be used in conjunction with Cayman’s IGFBP5 Polyclonal Antibody (Catalog No. 10008207) to block protein-antibody complex formation during immunochemical analysis of...
Reference: 234-0P
€0.00 (tax incl.)
IBA1 rt AIF 1, microglia, IBA1, AIF1, Aif 1
Reference: 380-1P
€0.00 (tax incl.)
HSP90 beta hu HSP90, HS90B
Reference: 380-0P
€0.00 (tax incl.)
HSP90 alpha hu HSP90, HS90A
Reference: 10006372-1
€0.00 (tax incl.)
Peptide Sequence: human HSL amino acids 731-741 (LCRETRQAAEL) · To be used in conjunction with Cayman’s HSL polyclonal antibody (Catalog No. 10006371) to block protein-antibody complex formation during immunochemical...
Reference: 27439-1
€0.00 (tax incl.)
A peptide substrate for CRK3/CYC6; phosphorylated by CRK3/CYC6 and has been used in high-throughput screening assays for the identification of CRK3/CYC6 inhibitors
Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
Reference: 100024-200
€0.00 (tax incl.)
Peptide Sequence: human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL) · To be used in conjunction with Cayman’s hepsin polyclonal antibody - affinity-purified (Catalog No. 100022) to block protein-antibody...
Reference: 245-0P
€0.00 (tax incl.)
HA-tag hu
Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Reference: 10005256-200
€0.00 (tax incl.)
Peptide Sequence: Human GPX4 amino acids 81-93 · To be used in conjunction with Cayman’s GPX4 Polyclonal Antibody (Item No.10005258) to block protein-antibody complex formation during analysis for GPX4
Reference: 10225-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s GPR55 Polyclonal Antibody to block protein-antibody complex formation during immunochemical analysis of GPR55 for WB
Reference: 10007206-1
€0.00 (tax incl.)
Peptide Sequence: human GPR40 amino acids 210-222 · To be used in conjunction with Cayman’s GPR40 polyclonal antibody (Catalog No. 10007605) to block protein-antibody complex formation during immunochemical analysis...
Reference: 10007661-1
€0.00 (tax incl.)
Peptide Sequence: human GPR35 · To be used in conjunction with Cayman’s GPR35 polyclonal antibody (Catalog No. 10007660) to block protein-antibody complex formation during immunochemical analysis of GPR35.
Reference: 456-0P
€0.00 (tax incl.)
Glutaminase1 rt Glutaminase kidney isoform, mitochondrial, GLS, K-glutaminase, L-glutamine amidohydrolase, Glutaminase kidney isoform, mitochondrial 68 kDa chain, Glutaminase kidney isoform, mitochondrial 65 kDa chain
Reference: 235-0P
€0.00 (tax incl.)
GLUT4 hu SLC2A4, GLUT4, GT2
Reference: 244-1P
€0.00 (tax incl.)
GluN2B rt NMDA-receptor 2, GluN 2A/B, GluN 2B, GluN2A/B, GluN2B, NMDA-receptor 2 B
Reference: 244-0P
€0.00 (tax incl.)
GluN2A ms NMDA-receptor 2, GluN 2A/B, GluN 2B, GluN2A/B, GluN2B, NMDA-receptor 2A
Reference: 114-0P
€0.00 (tax incl.)
GluN1 rt NMDA-receptor 1, GluN1, NR1, NMDAR1
Reference: 182-2P
€0.00 (tax incl.)
GluA3 ms GluA 3, GluR 3, AMPA3, GluA3, GluR3, AMPA 3
Reference: 182-01P
€0.00 (tax incl.)
GluA1 rt GluA 1, GluR 1, AMPA1, GluA1, AMPA 1
Reference: 230-0P
€0.00 (tax incl.)
gamma-Enolase rt Enolase 2, NSE, Neural Enolase, ENO 2, ENOG, ENO2
Reference: 112-3P
€0.00 (tax incl.)
gamma SNAP rt NAPG, Snapg
Reference: 274-3P
€0.00 (tax incl.)
GABA transporter3 ms GATs, GAT 1, GAT 3, Gabt 1, Gabt 3, Slc6a1, Slc6a11, GAT3
Reference: 274-1P
€0.00 (tax incl.)
GABAtransporter1 ms GATs, GAT 1, GAT 3, Gabt 1, Gabt 3, Slc6a1, Slc6a11, GAT1
Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
Reference: 10006248-1
€0.00 (tax incl.)
Peptide Sequence: human FABP4 amino acids 103-118 · To be used in conjunction with Cayman’s FABP4 polyclonal antibody (Catalog No. 10004944) to block protein-antibody complex formation during immunochemical analysis...
Reference: 143-1P
€0.00 (tax incl.)
ERC2 rt ERC, CAST, ERC 1b, ERC 2, CAST 1, CAST 2a, ELKS 2
Reference: 143-0P
€0.00 (tax incl.)
Erc1b rt ERC, CAST, ERC 1b, ERC 2, CAST 1, CAST 2a, Erc1b, Cast2, ELKS, Cast2a
Reference: 101780-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI)(3164,3185,3186,2035) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody...
Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Reference: 10004111-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 19-32 (AGSPVPFGPEGRLE) · To be used in conjunction with Cayman’s endothelial lipase polyclonal antibody (Catalog No. 100030) to block protein-antibody complex formation during analysis...
Reference: 159-0P
€0.00 (tax incl.)
Endophilin1 ms SH3P4, SH3GL2, Endophilin 1, Endophilin A1, Endophilin A2, SH3P8, SH3GL1, Sh3 domain protein 2B
Reference: 237-0P
€0.00 (tax incl.)
EEA1 rt EEA1, Early endosome antigen 1
Reference: 250-31P
€0.00 (tax incl.)
EAAT3 rt GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3
Reference: 250-2P
€0.00 (tax incl.)
EAAT2 ms GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3, GLT1
Reference: 250-1P
€0.00 (tax incl.)
EAAT1 rt GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3
Reference: 250-11P
€0.00 (tax incl.)
EAAT1 rt GLAST, SLC1A3, GLT-1, SLC1A2, SLC1A1, EAAT1, EAAT2, EAAT3
Reference: 115-3P
€0.00 (tax incl.)
Dynamin3 ms dynamin 1, dynamin 2, dynamin 3
Reference: 115-0P
€0.00 (tax incl.)
Dynamin1 rt dynamin 1, dynamin 2, dynamin 3
Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
Reference: 10005516-200
€0.00 (tax incl.)
Peptide Sequence: human doppel protein amino acids 112-120 (ATQAANQGE) · To be used in conjunction with Cayman’s Doppel polyclonal antibody (Catalog No. 10005517) to block protein-antibody complex formation during...
Reference: 382-0P
€0.00 (tax incl.)
Darpp32 ms PPP1R1B, DARPP32, DARPP-32, Dopamine- and cAMP-regulated neuronal phosphoprotein, Ppp1r1b
Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...

Menu

Settings