Category: Peptides

Filter By
Brand: Cayman Chemical Brand: Synaptic Systems Clear all
CysLT1 Receptor Blocking Peptide CysLT1 Receptor Blocking Peptide

CysLT1 Receptor Blocking Peptide

Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
CtBP 1 CtBP 1

CtBP 1

Reference: 222-0P
€0.00 (tax incl.)
CtBP1 rt BARS, CtBP1
CRTH2/DP2 Receptor (N-Term) Blocking Peptide CRTH2/DP2 Receptor (N-Term) Blocking Peptide

CRTH2/DP2 Receptor (N-Term) Blocking Peptide

Reference: 10004884-200
€0.00 (tax incl.)
Peptide Sequence: CRTH2/DP2 protein amino acids 2-21 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (N-Term) polyclonal antibody (Item No. 10004886) to block protein-antibody complex formation during...
CRTH2/DP2 Receptor (C-Term) Blocking Peptide CRTH2/DP2 Receptor (C-Term) Blocking Peptide

CRTH2/DP2 Receptor (C-Term) Blocking Peptide

Reference: 10007003-1
€0.00 (tax incl.)
Peptide Sequence: CRTH2/DP2 protein amino acids 378-395 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (C-Term) polyclonal antibody (Catalog No. 10007002) to block protein-antibody complex formation...
CPT1c CPT1c

CPT1c

Reference: 415-0P
€0.00 (tax incl.)
Cpt1c ms CPT1c, CPTI-B
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
COX 4 COX 4

COX 4

Reference: 298-0P
€0.00 (tax incl.)
COX4 ms COX, COX IV, Cox4, Cox IV-1
Complexin 1/2 Complexin 1/2

Complexin 1/2

Reference: 122-0P
€0.00 (tax incl.)
Complexin2 hu Synaphin 1, Synaphin 2, CPX 1, CPX 2, Complexin 1, Complexin 2, Complexin I, Complexin II, CPX I, CPX II, CPX1, CPX2, Cplx1, 2
CNIH 2 CNIH 2

CNIH 2

Reference: 253-2P
€0.00 (tax incl.)
CNIH2 ms Cornichon, CNIH 2, CNIH 3, CNIH2, CNIH3, Cornichon 2
Claudin 11 Claudin 11

Claudin 11

Reference: 241-0P
€0.00 (tax incl.)
Claudin11 rt OSP, claudin11, Otm, Cldn11, OPS, Oligodendrocyte-specific protein
ChREBP Blocking Peptide ChREBP Blocking Peptide

ChREBP Blocking Peptide

Reference: 10006790-1
€0.00 (tax incl.)
Peptide Sequence: murine amino acids 715-735 · To be used in conjunction with Cayman’s ChREBP polyclonal antibody (Catalog No. 10006789) to block protein-antibody complex formation during immunochemical analysis of...
Chil3 / YM1 Chil3 / YM1

Chil3 / YM1

Reference: 442-0P
€0.00 (tax incl.)
Chil3 ms Chitinase-like protein 3, Beta-N-acetylhexosaminidase Ym1, ECF-L, Chitinase-3-like protein 3, Eosinophil chemotactic cytokine, Secreted protein Ym1, Chi3l3, Ym1
Cellular Retinol Binding Protein 7 Blocking Peptide Cellular Retinol Binding Protein 7 Blocking Peptide

Cellular Retinol Binding Protein 7 Blocking Peptide

Reference: 10010251-1
€0.00 (tax incl.)
Peptide Sequence: synthetic peptide from human cRBP7 amino acids 125-134 (QVCKQTFQRA) · To be used in conjunction with Cayman’s Cellular Retinol Binding Protein 7 polyclonal antibody (Catalog No. 10010251) to block...
Cellubrevin Cellubrevin

Cellubrevin

Reference: 104-1P
€0.00 (tax incl.)
Cellubrevin rt VAMP 3, Synaptobrevin 3, Vamp 3, Vamp3, CEB
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
CB1 Receptor (C-Term) Blocking Peptide CB1 Receptor (C-Term) Blocking Peptide

CB1 Receptor (C-Term) Blocking Peptide

Reference: 10006591-1
€0.00 (tax incl.)
Peptide Sequence: CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 Receptor (C-Term) polyclonal antibody (Item No. 10006590) to block protein-antibody complex formation during...
Caveolin 1/3 Blocking Peptide Caveolin 1/3 Blocking Peptide

Caveolin 1/3 Blocking Peptide

Reference: 300830-200
€0.00 (tax incl.)
Peptide Sequence: rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF)(3942) · To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex...
Caveolin 1 Caveolin 1

Caveolin 1

Reference: 161-0P
€0.00 (tax incl.)
Caveolin1 rt Caveolin 1, Cav1
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
CASKIN 1 CASKIN 1

CASKIN 1

Reference: 185-0P
€0.00 (tax incl.)
CASKIN1 rt
Calmodulin Calmodulin

Calmodulin

Reference: 301-0P
€0.00 (tax incl.)
Calmodulin rt CaM
c-Fos c-Fos

c-Fos

Reference: 226-0P
€0.00 (tax incl.)
c-Fos rt v-Fos
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-500
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-5
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-10
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-1
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
BLT1 Receptor Blocking Peptide BLT1 Receptor Blocking Peptide

BLT1 Receptor Blocking Peptide

Reference: 120112-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...
Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt) Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Reference: 27411-500
€0.00 (tax incl.)
An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
beta3-Tubulin beta3-Tubulin

beta3-Tubulin

Reference: 302-3P
€0.00 (tax incl.)
beta3-Tubulin ms TuJ1, TUBB3
beta3-Integrin beta3-Integrin

beta3-Integrin

Reference: 240-3P
€0.00 (tax incl.)
beta3-Integrin ms Integrins, VLA, CD 29, CD 61, CD29, CD61, Itgb3
beta1-Integrin beta1-Integrin

beta1-Integrin

Reference: 240-0P
€0.00 (tax incl.)
beta1-Integrin ms Integrins, VLA, CD 29, CD 61, CD29, CD61, Itgb3
beta-Catenin beta-Catenin

beta-Catenin

Reference: 281-0P
€0.00 (tax incl.)
beta-Catenin ms CTNNB1, beta-Catenin, Catenin alpha-2, Catnb, CTNNB 1
beta SNAP beta SNAP

beta SNAP

Reference: 112-2P
€0.00 (tax incl.)
beta SNAP ms Beta-soluble NSF attachment protein
ATP1B2 ATP1B2

ATP1B2

Reference: 407-0P
€0.00 (tax incl.)
ATP1B2 ms AMOG, ATP1B2
ASPEP ASPEP

ASPEP

Reference: 296-0P
€0.00 (tax incl.)
ASPEP ms DNPEP, DAP, Aspartyl Aminopeptidase
APP APP

APP

Reference: 127-0P
€0.00 (tax incl.)
APP rt amyloid precursor protein
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
AP 180 AP 180

AP 180

Reference: 155-0P
€0.00 (tax incl.)
AP180 rt pp155, NP185, F1-20, SNAP 91, AP 3, AP180, SNAP91
Amphiphysin Amphiphysin

Amphiphysin

Reference: 120-0P
€0.00 (tax incl.)
Amphiphysin rt AMPH
alpha-Tubulin alpha-Tubulin

alpha-Tubulin

Reference: 302-21P
€0.00 (tax incl.)
alpha-tubulin 4A hu Delta2-Tubulin, Glu-alpha-Tubulin, Tyr-alpha-Tubulin, TUBA1, alpha-Tubulin
Aldh1L1 Aldh1L1

Aldh1L1

Reference: 278-0P
€0.00 (tax incl.)
Aldh1L1 rt FDH, FDN
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
AiF AiF

AiF

Reference: 300-0P
€0.00 (tax incl.)
AiF ms PDCD8, PDCD 8
Adipose Triglyceride Lipase Blocking Peptide Adipose Triglyceride Lipase Blocking Peptide

Adipose Triglyceride Lipase Blocking Peptide

Reference: 10008492-1
€0.00 (tax incl.)
Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) · To be used in conjunction with Cayman’s Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-50
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-5
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-10
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-1
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
5-OxoETE Receptor Blocking Peptide 5-OxoETE Receptor Blocking Peptide

5-OxoETE Receptor Blocking Peptide

Reference: 10006618-1
€0.00 (tax incl.)
Peptide Sequence: human 5-OxoETE receptor C-terminal amino acids 408-423 (KVQGEVSLEKEGSSQG) · To be used in conjunction with Cayman’s 5-OxoETE Receptor polyclonal antibody (Catalog No. 100025) to block...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-500
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-250
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-100
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
15-Lipoxygenase-2 Blocking Peptide 15-Lipoxygenase-2 Blocking Peptide

15-Lipoxygenase-2 Blocking Peptide

Reference: 10004457-200
€0.00 (tax incl.)
Immunogen: Synthetic peptide from the internal region of 15-LO-2 · To be used in conjunction with Cayman’s 15-LO-2 polyclonal antibody (Catalog No. 10004454) to block protein-antibody complex formation during...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide 11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide

11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide

Reference: 10005729-1
€0.00 (tax incl.)
Peptide Sequence: human 11β-HSD1 amino acids 78-92 (CLELGAASAHYLAGT) · To be used in conjunction with Cayman’s 11β-HSD1 polyclonal antibody (Catalog No. 10004303) to block protein-antibody complex formation during...

Menu

Settings

Please sign in first.

Sign in