Category: Peptides

Filter By
Brand: Cayman Chemical Brand: Synaptic Systems Clear all
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Optineurin (C-Term) Blocking Peptide Optineurin (C-Term) Blocking Peptide

Optineurin (C-Term) Blocking Peptide

Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
Optineurin (INT) Blocking Peptide Optineurin (INT) Blocking Peptide

Optineurin (INT) Blocking Peptide

Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
HIF-1α (C-Term) Blocking Peptide HIF-1α (C-Term) Blocking Peptide

HIF-1α (C-Term) Blocking Peptide

Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
β-Catenin Blocking Peptide β-Catenin Blocking Peptide

β-Catenin Blocking Peptide

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Monoacylglycerol Lipase Blocking Peptide Monoacylglycerol Lipase Blocking Peptide

Monoacylglycerol Lipase Blocking Peptide

Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Fatty Acid Amide Hydrolase Blocking Peptide Fatty Acid Amide Hydrolase Blocking Peptide

Fatty Acid Amide Hydrolase Blocking Peptide

Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
DP1 Receptor Blocking Peptide DP1 Receptor Blocking Peptide

DP1 Receptor Blocking Peptide

Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
PPARγ Blocking Peptide PPARγ Blocking Peptide

PPARγ Blocking Peptide

Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
PPARα Blocking Peptide PPARα Blocking Peptide

PPARα Blocking Peptide

Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
EP1 Receptor Blocking Peptide EP1 Receptor Blocking Peptide

EP1 Receptor Blocking Peptide

Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
EP2 Receptor Blocking Peptide EP2 Receptor Blocking Peptide

EP2 Receptor Blocking Peptide

Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
EP3 Receptor Blocking Peptide EP3 Receptor Blocking Peptide

EP3 Receptor Blocking Peptide

Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
EP4 Receptor (C-Term) Blocking Peptide EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
RICK Blocking Peptide RICK Blocking Peptide

RICK Blocking Peptide

Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
CysLT1 Receptor Blocking Peptide CysLT1 Receptor Blocking Peptide

CysLT1 Receptor Blocking Peptide

Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
CysLT2 Receptor (C-Term) Blocking Peptide CysLT2 Receptor (C-Term) Blocking Peptide

CysLT2 Receptor (C-Term) Blocking Peptide

Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
CysLT2 Receptor (N-Term) Blocking Peptide CysLT2 Receptor (N-Term) Blocking Peptide

CysLT2 Receptor (N-Term) Blocking Peptide

Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
IP Receptor (mouse) Blocking Peptide IP Receptor (mouse) Blocking Peptide

IP Receptor (mouse) Blocking Peptide

Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Prostaglandin E Synthase (cytosolic) Blocking Peptide Prostaglandin E Synthase (cytosolic) Blocking Peptide

Prostaglandin E Synthase (cytosolic) Blocking Peptide

Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
sPLA2 (mouse Type V) Blocking Peptide sPLA2 (mouse Type V) Blocking Peptide

sPLA2 (mouse Type V) Blocking Peptide

Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Monoclonal) PAF Receptor Blocking Peptide (Monoclonal)

PAF Receptor Blocking Peptide (Monoclonal)

Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
Synaptophysin 1 Synaptophysin 1

Synaptophysin 1

Reference: 101-0P
€0.00 (tax incl.)
Synaptophysin1 hu p38-1, Synaptophysin1
Synaptoporin Synaptoporin

Synaptoporin

Reference: 102-0P
€0.00 (tax incl.)
Synaptoporin rt Synaptophysin 2, p38-2
Synaptogyrin 2 Synaptogyrin 2

Synaptogyrin 2

Reference: 103-02P
€0.00 (tax incl.)
Synaptogyrin2 rt Cellugyrin, Syngr2
Synaptogyrin 1 Synaptogyrin 1

Synaptogyrin 1

Reference: 103-0P
€0.00 (tax incl.)
Synaptogyrin1 rt p29, syngr1
Synaptobrevin 1 Synaptobrevin 1

Synaptobrevin 1

Reference: 104-0P
€0.00 (tax incl.)
Synaptobrevin1 rt VAMP 1, p18-1, Vamp1
Cellubrevin Cellubrevin

Cellubrevin

Reference: 104-1P
€0.00 (tax incl.)
Cellubrevin rt VAMP 3, Synaptobrevin 3, Vamp 3, Vamp3, CEB
Synaptobrevin 2 Synaptobrevin 2

Synaptobrevin 2

Reference: 104-2P
€0.00 (tax incl.)
Synaptobrevin2 rt VAMP 2, p18-2, Vamp2
Syntaxin 1B Syntaxin 1B

Syntaxin 1B

Reference: 110-1BP
€0.00 (tax incl.)
Syntaxin1B rt p35, Syntaxin 1A, Syntaxin 1B, stx 1, stx 1A, stx 1B, stx1, p35B
SNAP 25 SNAP 25

SNAP 25

Reference: 111-0P
€0.00 (tax incl.)
SNAP25 hu SNAP25, SUP
SNAP 23 SNAP 23

SNAP 23

Reference: 111-2P
€0.00 (tax incl.)
SNAP23 hu Syndet, SNAP23
beta SNAP beta SNAP

beta SNAP

Reference: 112-2P
€0.00 (tax incl.)
beta SNAP ms Beta-soluble NSF attachment protein
gamma SNAP gamma SNAP

gamma SNAP

Reference: 112-3P
€0.00 (tax incl.)
gamma SNAP rt NAPG, Snapg
GluN 1 GluN 1

GluN 1

Reference: 114-0P
€0.00 (tax incl.)
GluN1 rt NMDA-receptor 1, GluN1, NR1, NMDAR1
Dynamin 1/2/3 Dynamin 1/2/3

Dynamin 1/2/3

Reference: 115-0P
€0.00 (tax incl.)
Dynamin1 rt dynamin 1, dynamin 2, dynamin 3
Dynamin 3 Dynamin 3

Dynamin 3

Reference: 115-3P
€0.00 (tax incl.)
Dynamin3 ms dynamin 1, dynamin 2, dynamin 3
Munc18-1 Munc18-1

Munc18-1

Reference: 116-0P
€0.00 (tax incl.)
Munc18-1 rt rb-Sec1, n-Sec1, p67, stxbp2, stxbp1, Munc 18-1, Munc 18-2, Munc 18-3, Munc18
Munc18-3 Munc18-3

Munc18-3

Reference: 116-2P
€0.00 (tax incl.)
Munc18-3 rt rb-Sec1, n-Sec1, p67, stxbp2, stxbp1, Munc 18-1, Munc 18-2, Munc 18-3, Munc18
IP3-receptor type 1 IP3-receptor type 1

IP3-receptor type 1

Reference: 117-0P
€0.00 (tax incl.)
IP3-receptortype1 rt InsP3, IP3R1, PCD-6
Rabphilin 3a Rabphilin 3a

Rabphilin 3a

Reference: 118-0P
€0.00 (tax incl.)
Rabphilin3a rt Exophilin 1, Rabphilin 3a, Rph3a
SV2 A SV2 A

SV2 A

Reference: 119-0P
€0.00 (tax incl.)
SV2A hu SV2 A, SV2A
SV2 B SV2 B

SV2 B

Reference: 119-1P
€0.00 (tax incl.)
SV2B rt SV2 B, SV2B
SV2 C SV2 C

SV2 C

Reference: 119-2P
€0.00 (tax incl.)
SV2C rt SV2 C, SV2C
Amphiphysin Amphiphysin

Amphiphysin

Reference: 120-0P
€0.00 (tax incl.)
Amphiphysin rt AMPH
SCAMP 1 SCAMP 1

SCAMP 1

Reference: 121-0P
€0.00 (tax incl.)
SCAMP1 rt SCAMP 1, SCAMP1
Complexin 1/2 Complexin 1/2

Complexin 1/2

Reference: 122-0P
€0.00 (tax incl.)
Complexin2 hu Synaphin 1, Synaphin 2, CPX 1, CPX 2, Complexin 1, Complexin 2, Complexin I, Complexin II, CPX I, CPX II, CPX1, CPX2, Cplx1, 2
NSF NSF

NSF

Reference: 123-0P
€0.00 (tax incl.)
NSF rt Vesicle-fusing ATPase, NEM-sensitive fusion protein, SKD2
PSD95 PSD95

PSD95

Reference: 124-0P
€0.00 (tax incl.)
PSD95 rt SAP 90, DLG 4, Disks large homolog 4, DLGH 4, PSD95, SAP90, SAP 90
PSD93 PSD93

PSD93

Reference: 124-1P
€0.00 (tax incl.)
PSD93 rt Chapsin 110, DLG 2, Disks large homolog 2, DLGH 2, PSD93
SAP 102 SAP 102

SAP 102

Reference: 124-2P
€0.00 (tax incl.)
SAP102 rt DLG 3, Disks large homolog 3, DLGH 3, SAP102, DLG3
SAP 97 SAP 97

SAP 97

Reference: 124-3P
€0.00 (tax incl.)
SAP97 rt DLG 1, Disks large homolog 1, DLGH 1, SAP97, DLG1
APP APP

APP

Reference: 127-0P
€0.00 (tax incl.)
APP rt amyloid precursor protein
Neuroligin 2 Neuroligin 2

Neuroligin 2

Reference: 129-2P
€0.00 (tax incl.)
Neuroligin2 rt Neuroligin2, Nlgn2
Neuroligin 3 Neuroligin 3

Neuroligin 3

Reference: 129-3P
€0.00 (tax incl.)
Neuroligin3 ms Neuroligin 3, Nlgn3
Neuroligin 4 Neuroligin 4

Neuroligin 4

Reference: 129-4P
€0.00 (tax incl.)
Neuroligin4 ms Neuroligin4, Nlgn4
VGAT VGAT

VGAT

Reference: 131-0P
€0.00 (tax incl.)
VGAT rt VIAAT, SLC32A1
ERC 1b/2 ERC 1b/2

ERC 1b/2

Reference: 143-0P
€0.00 (tax incl.)
Erc1b rt ERC, CAST, ERC 1b, ERC 2, CAST 1, CAST 2a, Erc1b, Cast2, ELKS, Cast2a
ERC 2 ERC 2

ERC 2

Reference: 143-1P
€0.00 (tax incl.)
ERC2 rt ERC, CAST, ERC 1b, ERC 2, CAST 1, CAST 2a, ELKS 2
Synaptojanin 1 Synaptojanin 1

Synaptojanin 1

Reference: 145-0P
€0.00 (tax incl.)
Synaptojanin1 rt Synj1
Synaptojanin 1 Synaptojanin 1

Synaptojanin 1

Reference: 145-1P
€0.00 (tax incl.)
Synaptojanin1 rt Synj1
Snapin Snapin

Snapin

Reference: 148-1P
€0.00 (tax incl.)
Snapin rt Snapap, BLOC-1 subunit 7
AP 180 AP 180

AP 180

Reference: 155-0P
€0.00 (tax incl.)
AP180 rt pp155, NP185, F1-20, SNAP 91, AP 3, AP180, SNAP91
SynGAP SynGAP

SynGAP

Reference: 157-0P
€0.00 (tax incl.)
SynGAP rt p135 SynGAP, Neuronal RasGAP
Endophilin 1 Endophilin 1

Endophilin 1

Reference: 159-0P
€0.00 (tax incl.)
Endophilin1 ms SH3P4, SH3GL2, Endophilin 1, Endophilin A1, Endophilin A2, SH3P8, SH3GL1, Sh3 domain protein 2B
Caveolin 1 Caveolin 1

Caveolin 1

Reference: 161-0P
€0.00 (tax incl.)
Caveolin1 rt Caveolin 1, Cav1
GluA1 GluA1

GluA1

Reference: 182-01P
€0.00 (tax incl.)
GluA1 rt GluA 1, GluR 1, AMPA1, GluA1, AMPA 1
GluA3 GluA3

GluA3

Reference: 182-2P
€0.00 (tax incl.)
GluA3 ms GluA 3, GluR 3, AMPA3, GluA3, GluR3, AMPA 3
CASKIN 1 CASKIN 1

CASKIN 1

Reference: 185-0P
€0.00 (tax incl.)
CASKIN1 rt
mGluR2 mGluR2

mGluR2

Reference: 191-1P
€0.00 (tax incl.)
mGluR2 rt mGluR 1, mGluR 2
CtBP 1 CtBP 1

CtBP 1

Reference: 222-0P
€0.00 (tax incl.)
CtBP1 rt BARS, CtBP1

Menu

Settings

Please sign in first.

Sign in