Category: Home

Filter By
Brand: Cayman Chemical Categories: Proteins & Peptides Clear all
1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol 1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

Reference: 10011300-500
€0.00 (tax incl.)
Has the fluorophore NBD attached to the ω-end of the stearoyl chain of SAG; may be used to study interactions with proteins, utilization by cells and liposomes, and for the development of assays for lipid metabolism
1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol 1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

Reference: 10011300-5
€0.00 (tax incl.)
Has the fluorophore NBD attached to the ω-end of the stearoyl chain of SAG; may be used to study interactions with proteins, utilization by cells and liposomes, and for the development of assays for lipid metabolism
1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol 1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

Reference: 10011300-10
€0.00 (tax incl.)
Has the fluorophore NBD attached to the ω-end of the stearoyl chain of SAG; may be used to study interactions with proteins, utilization by cells and liposomes, and for the development of assays for lipid metabolism
1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol 1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

1-NBD-Stearoyl-2-Arachidonoyl-sn-glycerol

Reference: 10011300-1
€0.00 (tax incl.)
Has the fluorophore NBD attached to the ω-end of the stearoyl chain of SAG; may be used to study interactions with proteins, utilization by cells and liposomes, and for the development of assays for lipid metabolism
11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide 11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide

11β-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide

Reference: 10005729-1
€0.00 (tax incl.)
Peptide Sequence: human 11β-HSD1 amino acids 78-92 (CLELGAASAHYLAGT) · To be used in conjunction with Cayman’s 11β-HSD1 polyclonal antibody (Catalog No. 10004303) to block protein-antibody complex formation during...
12-Lipoxygenase (platelet-type, mouse recombinant) 12-Lipoxygenase (platelet-type, mouse recombinant)

12-Lipoxygenase (platelet-type, mouse recombinant)

Reference: 10341-25
€0.00 (tax incl.)
Source: Active recombinant N-terminal His-tagged protein expressed in insect cells • Mr: 76.4 kDa • Platelet-type 12-Lipoxygenase (12-LO) catalyzes the formation of 12-HpETE from arachidonic acid.
15-hydroxy Prostaglandin Dehydrogenase (human, recombinant) 15-hydroxy Prostaglandin Dehydrogenase (human, recombinant)

15-hydroxy Prostaglandin Dehydrogenase (human, recombinant)

Reference: 10007950-100
€0.00 (tax incl.)
Source: Active human recombinant N-terminal GST-tagged protein expressed in E. coli • MW: 55 kDa • NAD+-dependent 15-PGDH catalyzes the oxidation of PGs to 15-keto metabolites that have greatly reduced biological...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
15-Lipoxygenase-2 (human recombinant) 15-Lipoxygenase-2 (human recombinant)

15-Lipoxygenase-2 (human recombinant)

Reference: 10011263-100
€0.00 (tax incl.)
Source: Active human recombinant C-terminal His-tagged protein expressed in E. coli • MW: 76 kDa • Expression of 15-LO-2 appears to be restricted to prostate, lung, skin, and cornea and may play a role in the normal...
15-Lipoxygenase-2 Blocking Peptide 15-Lipoxygenase-2 Blocking Peptide

15-Lipoxygenase-2 Blocking Peptide

Reference: 10004457-200
€0.00 (tax incl.)
Immunogen: Synthetic peptide from the internal region of 15-LO-2 · To be used in conjunction with Cayman’s 15-LO-2 polyclonal antibody (Catalog No. 10004454) to block protein-antibody complex formation during...
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-500
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-250
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-100
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
5-OxoETE Receptor Blocking Peptide 5-OxoETE Receptor Blocking Peptide

5-OxoETE Receptor Blocking Peptide

Reference: 10006618-1
€0.00 (tax incl.)
Peptide Sequence: human 5-OxoETE receptor C-terminal amino acids 408-423 (KVQGEVSLEKEGSSQG) · To be used in conjunction with Cayman’s 5-OxoETE Receptor polyclonal antibody (Catalog No. 100025) to block...
ACE2 (human, recombinant) ACE2 (human, recombinant)

ACE2 (human, recombinant)

Reference: 30587-20
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged protein expressed in HEK293 cells • Amino acids: 1-740 • MW: 86.7 kDa
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-50
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-5
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-10
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-1
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Adiponectin (human, recombinant) Adiponectin (human, recombinant)

Adiponectin (human, recombinant)

Reference: 32059-50
€0.00 (tax incl.)
Source: Recombinant C-terminal human IgG1 Fc-tagged adiponectin expressed in HEK293 cells • Amino acids: 19-244 • MW: 51.6 kDa
Adiponectin (human, recombinant) Adiponectin (human, recombinant)

Adiponectin (human, recombinant)

Reference: 32059-100
€0.00 (tax incl.)
Source: Recombinant C-terminal human IgG1 Fc-tagged adiponectin expressed in HEK293 cells • Amino acids: 19-244 • MW: 51.6 kDa
Adiponectin (human, recombinant) Adiponectin (human, recombinant)

Adiponectin (human, recombinant)

Reference: 32059-1
€0.00 (tax incl.)
Source: Recombinant C-terminal human IgG1 Fc-tagged adiponectin expressed in HEK293 cells • Amino acids: 19-244 • MW: 51.6 kDa
Adiponectin (mouse, recombinant) Adiponectin (mouse, recombinant)

Adiponectin (mouse, recombinant)

Reference: 32077-50
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Adiponectin (mouse, recombinant) Adiponectin (mouse, recombinant)

Adiponectin (mouse, recombinant)

Reference: 32077-100
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Adiponectin (mouse, recombinant) Adiponectin (mouse, recombinant)

Adiponectin (mouse, recombinant)

Reference: 32077-1
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Adipose Triglyceride Lipase Blocking Peptide Adipose Triglyceride Lipase Blocking Peptide

Adipose Triglyceride Lipase Blocking Peptide

Reference: 10008492-1
€0.00 (tax incl.)
Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) · To be used in conjunction with Cayman’s Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
AIMP1 (human, recombinant) AIMP1 (human, recombinant)

AIMP1 (human, recombinant)

Reference: 32058-50
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged AIMP1 expressed in E. coli • Amino acids: 2-312 (full length) • MW: 35 kDa
AIMP1 (human, recombinant) AIMP1 (human, recombinant)

AIMP1 (human, recombinant)

Reference: 32058-100
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged AIMP1 expressed in E. coli • Amino acids: 2-312 (full length) • MW: 35 kDa
AIMP1 (human, recombinant) AIMP1 (human, recombinant)

AIMP1 (human, recombinant)

Reference: 32058-1
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged AIMP1 expressed in E. coli • Amino acids: 2-312 (full length) • MW: 35 kDa
Annexin V (human, recombinant) Annexin V (human, recombinant)

Annexin V (human, recombinant)

Reference: 20594-100
€0.00 (tax incl.)
Source: Recombinant N-terminal GST-tagged annexin V expressed in E. coli • Amino acids: 2-320 (full length) • MW: 62.4 kDa
Anthrax Edema Factor (EF) (recombinant from Bacillus anthracis) Anthrax Edema Factor (EF) (recombinant from Bacillus anthracis)

Anthrax Edema Factor (EF) (recombinant from Bacillus anthracis)

Reference: 28210-100
€0.00 (tax incl.)
A component of EdTx produced by B. anthracis; comprised of an N-terminal PABD, an adenylyl cyclase domain, and a helical domain; binds oligomerized B. anthracis PA on the host cell surface; endocytosed by the host...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
ARG1 (human, recombinant) ARG1 (human, recombinant)

ARG1 (human, recombinant)

Reference: 32558-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged ARG1 expressed in HEK293 cells • Amino acids: 1-322 (full length) • MW: 36 kDa
ASH2L (human recombinant) ASH2L (human recombinant)

ASH2L (human recombinant)

Reference: 10946-50
€0.00 (tax incl.)
Recombinant protein expressed in E. coli with a SUMO tag • ASH2L is a component of various multisubunit protein complexes, including the large complex of proteins associated with the SET1 (MLL) family of lysine...
Autotaxin (human recombinant) Autotaxin (human recombinant)

Autotaxin (human recombinant)

Reference: 10803-100
€0.00 (tax incl.)
Source: recombinant C-terminal histidine-tagged protein expressed using a baculovirus overexpression system in Sf21 cells • Mr: 98.8 kDa • A secreted lysophospholipase D that catalyzes the hydrolysis of LPC to...
B7-H4 (human, recombinant) B7-H4 (human, recombinant)

B7-H4 (human, recombinant)

Reference: 31823-50
€0.00 (tax incl.)
Source: Active recombinant C-terminal human IgG1 Fc-tagged B7-H4 expressed in HEK293 cells • Amino acids: 29-258 • MW: 52.3 kDa
B7-H4 (human, recombinant) B7-H4 (human, recombinant)

B7-H4 (human, recombinant)

Reference: 31823-100
€0.00 (tax incl.)
Source: Active recombinant C-terminal human IgG1 Fc-tagged B7-H4 expressed in HEK293 cells • Amino acids: 29-258 • MW: 52.3 kDa
Bcl-xL (human, recombinant) Bcl-xL (human, recombinant)

Bcl-xL (human, recombinant)

Reference: 32024-50
€0.00 (tax incl.)
Source: Recombinant human C-terminal His-tagged Bcl-xL expressed in E. coli • Amino acids: 1-212 • MW: 25.2 kDa
Bcl-xL (human, recombinant) Bcl-xL (human, recombinant)

Bcl-xL (human, recombinant)

Reference: 32024-100
€0.00 (tax incl.)
Source: Recombinant human C-terminal His-tagged Bcl-xL expressed in E. coli • Amino acids: 1-212 • MW: 25.2 kDa
Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt) Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Reference: 27411-500
€0.00 (tax incl.)
An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
BLT1 Receptor Blocking Peptide BLT1 Receptor Blocking Peptide

BLT1 Receptor Blocking Peptide

Reference: 120112-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
BMP2 (recombinant) BMP2 (recombinant)

BMP2 (recombinant)

Reference: 32050-5
€0.00 (tax incl.)
Source: Active recombinant BMP2 expressed in E. coli • Amino acids: 283-396 • MW: 13 kDa
BMP2 (recombinant) BMP2 (recombinant)

BMP2 (recombinant)

Reference: 32050-20
€0.00 (tax incl.)
Source: Active recombinant BMP2 expressed in E. coli • Amino acids: 283-396 • MW: 13 kDa
BMP2 (recombinant) BMP2 (recombinant)

BMP2 (recombinant)

Reference: 32050-100
€0.00 (tax incl.)
Source: Active recombinant BMP2 expressed in E. coli • Amino acids: 283-396 • MW: 13 kDa
BMP2 (recombinant) BMP2 (recombinant)

BMP2 (recombinant)

Reference: 32050-1
€0.00 (tax incl.)
Source: Active recombinant BMP2 expressed in E. coli • Amino acids: 283-396 • MW: 13 kDa
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-500
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-5
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-10
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-1
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...

Menu

Settings

Please sign in first.

Sign in