Category: Home

Filter By
Brand: Cayman Chemical Categories: Proteins & Peptides Clear all
PPARγ FL (human, recombinant from E. coli) PPARγ FL (human, recombinant from E. coli)

PPARγ FL (human, recombinant from E. coli)

Reference: 61700-50
€0.00 (tax incl.)
Source: human recombinant N-terminal His-tagged protein expressed in E. coli · MW: ~60 kDa • PPARs are members of the nuclear receptor family of ligand activated transcription factors that heterodimerize with...
PPARγ FL (human, recombinant from E. coli) PPARγ FL (human, recombinant from E. coli)

PPARγ FL (human, recombinant from E. coli)

Reference: 61700-25
€0.00 (tax incl.)
Source: human recombinant N-terminal His-tagged protein expressed in E. coli · MW: ~60 kDa • PPARs are members of the nuclear receptor family of ligand activated transcription factors that heterodimerize with...
eNOS (bovine, recombinant) eNOS (bovine, recombinant)

eNOS (bovine, recombinant)

Reference: 60880-10
€0.00 (tax incl.)
MW: 135 kDa • Source: recombinant enzyme; isolated from a Baculovirus overexpression system in Sf9 cells
sPLA2 (Type III) sPLA2 (Type III)

sPLA2 (Type III)

Reference: 60500-5
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
sPLA2 (Type III) sPLA2 (Type III)

sPLA2 (Type III)

Reference: 60500-25
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
sPLA2 (Type III) sPLA2 (Type III)

sPLA2 (Type III)

Reference: 60500-10
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
sPLA2 (Type III) sPLA2 (Type III)

sPLA2 (Type III)

Reference: 60500-1
€0.00 (tax incl.)
EC 3.1.1.4 • Active enzyme isolated from bee venom • One unit of enzyme hydrolyzes one µmol of Diheptanoyl Thio-PC per minute at 25°C • PLA2 catalyzes the hydrolysis of fatty acids at the sn-2 position of...
COX-1 (ovine) COX-1 (ovine)

COX-1 (ovine)

Reference: 60100-5
€0.00 (tax incl.)
Isolated from ram seminal vesicles
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
nNOS Electrophoresis Standard nNOS Electrophoresis Standard

nNOS Electrophoresis Standard

Reference: 360870-1
€0.00 (tax incl.)
Each vial contains nNOS (rat) to be used as a standard for WB and electrophoresis. The enzyme has been carefully purified to exclude all unrelated proteins; may not be catalytically active.(1281)
iNOS Electrophoresis Standard iNOS Electrophoresis Standard

iNOS Electrophoresis Standard

Reference: 360862-1
€0.00 (tax incl.)
Each vial contains 5 µg of iNOS (murine macrophage) to be used as a standard for WB and electrophoresis. The enzyme has been carefully purified to exclude all unrelated proteins; may not be catalytically active.
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Monoclonal) PAF Receptor Blocking Peptide (Monoclonal)

PAF Receptor Blocking Peptide (Monoclonal)

Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
sPLA2 (mouse Type V) Blocking Peptide sPLA2 (mouse Type V) Blocking Peptide

sPLA2 (mouse Type V) Blocking Peptide

Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
Prostaglandin E Synthase (cytosolic) Blocking Peptide Prostaglandin E Synthase (cytosolic) Blocking Peptide

Prostaglandin E Synthase (cytosolic) Blocking Peptide

Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
COX-2 (ovine) Electrophoresis Standard COX-2 (ovine) Electrophoresis Standard

COX-2 (ovine) Electrophoresis Standard

Reference: 360120-1
€0.00 (tax incl.)
Cyclooxygenase catalyzes the first step in the biosynthesis of prostaglandins, thromboxanes, and prostacyclins: the conversion of arachidonic acid to prostaglandin H2. Recent discoveries of the induction of...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
COX-1 (ovine) Electrophoresis Standard COX-1 (ovine) Electrophoresis Standard

COX-1 (ovine) Electrophoresis Standard

Reference: 360100-1
€0.00 (tax incl.)
To be used as a standard for WB and electrophoresis. This enzyme has been carefully purified to exclude all unrelated proteins; may not be catalytically active. • COX-1 catalyzes the first step in the biosynthesis of...
IP Receptor (mouse) Blocking Peptide IP Receptor (mouse) Blocking Peptide

IP Receptor (mouse) Blocking Peptide

Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
ARG1 (human, recombinant) ARG1 (human, recombinant)

ARG1 (human, recombinant)

Reference: 32558-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged ARG1 expressed in HEK293 cells • Amino acids: 1-322 (full length) • MW: 36 kDa
CXCL12α (human, recombinant) CXCL12α (human, recombinant)

CXCL12α (human, recombinant)

Reference: 32093-20
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged CXCL12α expressed in E. coli • Amino acids: 22-89 • MW: 10 kDa
CXCL12α (human, recombinant) CXCL12α (human, recombinant)

CXCL12α (human, recombinant)

Reference: 32093-10
€0.00 (tax incl.)
Source: Recombinant human N-terminal His-tagged CXCL12α expressed in E. coli • Amino acids: 22-89 • MW: 10 kDa
INHBA (recombinant) INHBA (recombinant)

INHBA (recombinant)

Reference: 32091-50
€0.00 (tax incl.)
Source: Active recombinant INHBA expressed in HEK293 cells • Amino acids: 311-426 • MW: 13 kDa
INHBA (recombinant) INHBA (recombinant)

INHBA (recombinant)

Reference: 32091-10
€0.00 (tax incl.)
Source: Active recombinant INHBA expressed in HEK293 cells • Amino acids: 311-426 • MW: 13 kDa
IDS (human, recombinant) IDS (human, recombinant)

IDS (human, recombinant)

Reference: 32088-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged IDS expressed in HEK293 cells • Amino acids: 26-550 • MW: 61 kDa
IDS (human, recombinant) IDS (human, recombinant)

IDS (human, recombinant)

Reference: 32088-20
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged IDS expressed in HEK293 cells • Amino acids: 26-550 • MW: 61 kDa
Enteropeptidase (bovine, recombinant) Enteropeptidase (bovine, recombinant)

Enteropeptidase (bovine, recombinant)

Reference: 32087-20
€0.00 (tax incl.)
Source: Recombinant bovine C-terminal His-tagged enterokinase expressed in yeast • Amino acids: 801-1,035 • MW: 27.1 kDa
Enteropeptidase (bovine, recombinant) Enteropeptidase (bovine, recombinant)

Enteropeptidase (bovine, recombinant)

Reference: 32087-10
€0.00 (tax incl.)
Source: Recombinant bovine C-terminal His-tagged enterokinase expressed in yeast • Amino acids: 801-1,035 • MW: 27.1 kDa
VISTA (human, recombinant) VISTA (human, recombinant)

VISTA (human, recombinant)

Reference: 32086-50
€0.00 (tax incl.)
Source: Recombinant human C-terminal His-tagged VISTA expressed in HEK293 cells • Amino acids: 33-194 • MW: 19.6 kDa
VISTA (human, recombinant) VISTA (human, recombinant)

VISTA (human, recombinant)

Reference: 32086-100
€0.00 (tax incl.)
Source: Recombinant human C-terminal His-tagged VISTA expressed in HEK293 cells • Amino acids: 33-194 • MW: 19.6 kDa
CD47 (human, recombinant) CD47 (human, recombinant)

CD47 (human, recombinant)

Reference: 32085-50
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged CD47 expressed in HEK293 cells • Amino acids: 19-139 • MW: 15.2 kDa
CD47 (human, recombinant) CD47 (human, recombinant)

CD47 (human, recombinant)

Reference: 32085-200
€0.00 (tax incl.)
Source: Active recombinant human C-terminal His-tagged CD47 expressed in HEK293 cells • Amino acids: 19-139 • MW: 15.2 kDa
M-CSF-β (mouse, recombinant) M-CSF-β (mouse, recombinant)

M-CSF-β (mouse, recombinant)

Reference: 32080-5
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
M-CSF-β (mouse, recombinant) M-CSF-β (mouse, recombinant)

M-CSF-β (mouse, recombinant)

Reference: 32080-20
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
M-CSF-β (mouse, recombinant) M-CSF-β (mouse, recombinant)

M-CSF-β (mouse, recombinant)

Reference: 32080-100
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
M-CSF-β (mouse, recombinant) M-CSF-β (mouse, recombinant)

M-CSF-β (mouse, recombinant)

Reference: 32080-1
€0.00 (tax incl.)
Source: Recombinant mouse M-CSF-β expressed in HEK293 cells • Amino acids: 33-262 • MW: 26 kDa
GM-CSF (mouse, recombinant) GM-CSF (mouse, recombinant)

GM-CSF (mouse, recombinant)

Reference: 32079-50
€0.00 (tax incl.)
Source: Active recombinant mouse GM-CSF expressed in HEK293 cells • Amino acids: 18-141 • MW: 14.1 kDa
GM-CSF (mouse, recombinant) GM-CSF (mouse, recombinant)

GM-CSF (mouse, recombinant)

Reference: 32079-20
€0.00 (tax incl.)
Source: Active recombinant mouse GM-CSF expressed in HEK293 cells • Amino acids: 18-141 • MW: 14.1 kDa
GM-CSF (mouse, recombinant) GM-CSF (mouse, recombinant)

GM-CSF (mouse, recombinant)

Reference: 32079-1
€0.00 (tax incl.)
Source: Active recombinant mouse GM-CSF expressed in HEK293 cells • Amino acids: 18-141 • MW: 14.1 kDa
IFN-γ (mouse, recombinant) IFN-γ (mouse, recombinant)

IFN-γ (mouse, recombinant)

Reference: 32078-200
€0.00 (tax incl.)
Source: Active recombinant mouse IFN-γ expressed in HEK293 cells • Amino acids: 23-155 • MW: 15.5 kDa
IFN-γ (mouse, recombinant) IFN-γ (mouse, recombinant)

IFN-γ (mouse, recombinant)

Reference: 32078-100
€0.00 (tax incl.)
Source: Active recombinant mouse IFN-γ expressed in HEK293 cells • Amino acids: 23-155 • MW: 15.5 kDa
IFN-γ (mouse, recombinant) IFN-γ (mouse, recombinant)

IFN-γ (mouse, recombinant)

Reference: 32078-1
€0.00 (tax incl.)
Source: Active recombinant mouse IFN-γ expressed in HEK293 cells • Amino acids: 23-155 • MW: 15.5 kDa
Adiponectin (mouse, recombinant) Adiponectin (mouse, recombinant)

Adiponectin (mouse, recombinant)

Reference: 32077-50
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Adiponectin (mouse, recombinant) Adiponectin (mouse, recombinant)

Adiponectin (mouse, recombinant)

Reference: 32077-100
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
Adiponectin (mouse, recombinant) Adiponectin (mouse, recombinant)

Adiponectin (mouse, recombinant)

Reference: 32077-1
€0.00 (tax incl.)
Source: Recombinant mouse C-terminal His-tagged adiponectin expressed in HEK293 cells • Amino acids: 18-247 • MW: 26.4 kDa
β-NGF (mouse, recombinant) β-NGF (mouse, recombinant)

β-NGF (mouse, recombinant)

Reference: 32076-5
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
β-NGF (mouse, recombinant) β-NGF (mouse, recombinant)

β-NGF (mouse, recombinant)

Reference: 32076-20
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
β-NGF (mouse, recombinant) β-NGF (mouse, recombinant)

β-NGF (mouse, recombinant)

Reference: 32076-100
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
β-NGF (mouse, recombinant) β-NGF (mouse, recombinant)

β-NGF (mouse, recombinant)

Reference: 32076-1
€0.00 (tax incl.)
Source: Active recombinant mouse β-NGF expressed in CHO cells • Amino acids: 122-241 • MW: 13.5 kDa
PVR/CD155 (mouse, recombinant) PVR/CD155 (mouse, recombinant)

PVR/CD155 (mouse, recombinant)

Reference: 32073-50
€0.00 (tax incl.)
Source: Active recombinant C-terminal human IgG1 Fc-His-tagged mouse PVR expressed in HEK293 cells • Amino acids: 28-345 • MW: 63 kDa
PVR/CD155 (mouse, recombinant) PVR/CD155 (mouse, recombinant)

PVR/CD155 (mouse, recombinant)

Reference: 32073-100
€0.00 (tax incl.)
Source: Active recombinant C-terminal human IgG1 Fc-His-tagged mouse PVR expressed in HEK293 cells • Amino acids: 28-345 • MW: 63 kDa
VEGF-A 164 variant (mouse, recombinant) VEGF-A 164 variant (mouse, recombinant)

VEGF-A 164 variant (mouse, recombinant)

Reference: 32068-5
€0.00 (tax incl.)
Source: Active recombinant mouse VEGF-A 164 variant expressed in insect cells (baculovirus) • Amino acids: 27-190 • MW: 19.4 kDa
VEGF-A 164 variant (mouse, recombinant) VEGF-A 164 variant (mouse, recombinant)

VEGF-A 164 variant (mouse, recombinant)

Reference: 32068-20
€0.00 (tax incl.)
Source: Active recombinant mouse VEGF-A 164 variant expressed in insect cells (baculovirus) • Amino acids: 27-190 • MW: 19.4 kDa
VEGF-A 164 variant (mouse, recombinant) VEGF-A 164 variant (mouse, recombinant)

VEGF-A 164 variant (mouse, recombinant)

Reference: 32068-100
€0.00 (tax incl.)
Source: Active recombinant mouse VEGF-A 164 variant expressed in insect cells (baculovirus) • Amino acids: 27-190 • MW: 19.4 kDa

Menu

Settings

Please sign in first.

Sign in