Category: Peptides

Filter By
Brand: Agrisera Brand: Signalchem Clear all
AtpC | gamma subunit of ATP synthase, blocking peptide AtpC | gamma subunit of ATP synthase, blocking peptide

AtpC | gamma subunit of ATP synthase, blocking peptide

Reference: AS09 312P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AtpC | gamma subunit of ATP synthase before immunolocalization or western blot. Furter details are provided below.ATP synthase produces ATP from ADP in the...
AGO1 | Argonaute 1, Blocking peptide AGO1 | Argonaute 1, Blocking peptide

AGO1 | Argonaute 1, Blocking peptide

Reference: AS09 527P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AGO1 | argonaute 1 before immunolocalization or western blot. Furter details are provided below.AGO1 belongs to a group of argonaute proteins which are...
Dehydrin blocking peptide Dehydrin blocking peptide

Dehydrin blocking peptide

Reference: AS10 206S
€0.00 (tax incl.)
Dehydrins are stress proteins involved in formation of plant protective reactions against dehydration. They are normally synthesized in maturating seeds during their dessication, as well as in vegetative tissues of...
Patatin | Blocking peptide Patatin | Blocking peptide

Patatin | Blocking peptide

Reference: AS12 1842P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize Patatin before immunolocalization or western blot. Furter details are provided below.Patatin is the most abundant protein in potato (Solanum tuberosum L.)...
NpHR | Halorhodopsin blocking peptide NpHR | Halorhodopsin blocking peptide

NpHR | Halorhodopsin blocking peptide

Reference: AS12 1851P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize Halorhodopsin before immunolocalization or western blot. Furter details are provided below.Halorhodopsin (HR) is a hyperpolarizing light-driven ion pump...
AHK2 | Histidine kinase 2, Blocking peptide AHK2 | Histidine kinase 2, Blocking peptide

AHK2 | Histidine kinase 2, Blocking peptide

Reference: AS12 2113P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AHK2 | Histidine kinase 2 before immunolocalization or western blot. Furter details are provided below.AHK2 (Histidine kinase 2) is a cytokinin receptor,...
Abltide Abltide

Abltide

Reference: A02-58-1000
€0.00 (tax incl.)
The Abltide peptide sequence (EAIYAAPFAKKK) is based on the C-terminus of Abl.
Acetylated Histone H3 Peptide I Acetylated Histone H3 Peptide I

Acetylated Histone H3 Peptide I

Reference: H12-358-500
€0.00 (tax incl.)
The Acetylated Histone H3 (K9, 14) Peptide sequence (ARTKQTAR[Ac-K]STGG[Ac-K]APRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the assay control of histone (de-)methylation and (de-)...
Acetylated Histone H4 Peptide I Acetylated Histone H4 Peptide I

Acetylated Histone H4 Peptide I

Reference: H13-358-500
€0.00 (tax incl.)
The Acetylated Histone H4 (K5, 8, 12, 16) Peptide sequence (SGRG[Ac-K]GG[Ac-K]GLG[Ac-K]GGA[Ac-K]RHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the assay control of histone...
AMARA Peptide AMARA Peptide

AMARA Peptide

Reference: A11-58
€0.00 (tax incl.)
The AMARA substrate peptide sequence (AMARAASAAALARRR) is routinely evaluated as a substrate for SIK and AMPK.
Autocamtide 2 Autocamtide 2

Autocamtide 2

Reference: A15-58
€0.00 (tax incl.)
The Autocamtide 2 peptide sequence (KKALRRQETVDAL-amide) is based on the autophosphorylation site (amino acid 283-290) on CaMKII.
Axltide Axltide

Axltide

Reference: A16-58
€0.00 (tax incl.)
The Axltide peptide sequence (KKSRGDYMTMQIG) is based on the mouse Insulin receptor substrate 1 (amino acid 979-989).
CATCHtide CATCHtide

CATCHtide

Reference: C02-58
€0.00 (tax incl.)
The CATCHtide peptide sequence (CRRHYYYDTHTNTYY-LRTFGHNTRR) is derived from human SLC12A2 (amino acids 198-217) and is suitable as a substrate for kinases OSR1 and STK39.
CDKtide CDKtide

CDKtide

Reference: C06-58
€0.00 (tax incl.)
The CDKtide peptide sequence (CKKKYSPTSPSYSPTSPSY-SPTSPS) is derived from the C-terminus of the largest subunit of human RNA polymerase II which has 52 approximate tandem repeats of 7 amino acids...
Chktide Chktide

Chktide

Reference: C10-58
€0.00 (tax incl.)
The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).
CK1tide CK1tide

CK1tide

Reference: C07-58-1
€0.00 (tax incl.)
The CK1tide synthetic peptide [HAAIGDDDDAYSITA-NH2] is routinely evaluated as a substrate for CK1 family kinases, such as CK1 and CK1 delta.
CREBtide CREBtide

CREBtide

Reference: C50-58
€0.00 (tax incl.)
The CREBtide peptide sequence (KRREILSRRPSYR) is based on the human CREB1 isoform A (amino acid 109-121).
Crosstide Crosstide

Crosstide

Reference: C51-58
€0.00 (tax incl.)
The Crosstide peptide sequence (GRPRTSSFAEG) is based on the GSK3.
CSKtide CSKtide

CSKtide

Reference: C63-58
€0.00 (tax incl.)
The synthetic peptide CSKtide (KKKEEIYFFFG-NH2) contains a tyrosine protein kinase phosphorylation site and can be used for CSK and TNK1 assay.
DYRKtide DYRKtide

DYRKtide

Reference: D96-58
€0.00 (tax incl.)
The synthetic peptide (RRRFRPASPLRGPPK) contains a serine/threonine protein kinase phosphorylation site and is routinely evaluated as a substrate for DYRK family kinases.
EF2tide EF2tide

EF2tide

Reference: E01-58
€0.00 (tax incl.)
The EF2tide substrate peptide sequence (RKKFGESEKTKTKEFL) is based on dictyostelium myosin II heavy chain (amino acid 2020-2035).
EIF2S Peptide EIF2S Peptide

EIF2S Peptide

Reference: E23-58
€0.00 (tax incl.)
The 13 amino acids of EIF2S peptide sequence (CILLSELSRRRIR) is derived from human protein EIF2S1 between residues 46-57. This peptide is suitable for use as a substrate for MNK1 and EIF2AK family kinases.
GRKtide GRKtide

GRKtide

Reference: G46-58
€0.00 (tax incl.)
The synthetic peptide sequence (CRRREEEEESAAA) is routinely evaluated as a substrate for GRK family kinases, including GRK2, GRK3, GRK4 and GRK7.
GS Peptide GS Peptide

GS Peptide

Reference: G60-58
€0.00 (tax incl.)
The GS peptide sequence (PLSRTLSVSS) is derived from an N-terminus of glycogen synthase and is suitable for use as the substrate for DCAMKL1 and CAMKII family.
Histone H1 Peptide Histone H1 Peptide

Histone H1 Peptide

Reference: H10-58-1
€0.00 (tax incl.)
The Histone H1 Peptide (152-159) sequence (GGGPATP-KKAKKL-COOH) is derived from human histone H1 between amino acids 152-159 and is suitable for use as the substrate for CDK family kinase assays, such as CDK1, CDK2,...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-500
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-01
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-500
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-01
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
HSP27tide HSP27tide

HSP27tide

Reference: H31-58
€0.00 (tax incl.)
The HSP27tide peptide sequence (RRLNRQLSVA-amide) is based on the mouse HSP27 (amino acid 80-85).
IGF1Rtide IGF1Rtide

IGF1Rtide

Reference: I15-58
€0.00 (tax incl.)
The 14 amino acids of IGF1Rtide peptide sequence (KKKSPGEYVNIEFG) is derived from human IRS-1 protein residues 891-902.
IKKtide IKKtide

IKKtide

Reference: I33-58
€0.00 (tax incl.)
The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.
IRS1 (Y608) Peptide IRS1 (Y608) Peptide

IRS1 (Y608) Peptide

Reference: I40-58-1000
€0.00 (tax incl.)
The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.
JAK3tide JAK3tide

JAK3tide

Reference: J03-58-1000
€0.00 (tax incl.)
The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.
LKBtide LKBtide

LKBtide

Reference: L15-58
€0.00 (tax incl.)
The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.
LRRKtide LRRKtide

LRRKtide

Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
MARCKS Peptide MARCKS Peptide

MARCKS Peptide

Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Micro2 Peptide Micro2 Peptide

Micro2 Peptide

Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
MLC Peptide MLC Peptide

MLC Peptide

Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Modified EIF2S Peptide Modified EIF2S Peptide

Modified EIF2S Peptide

Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Modified PLKtide Modified PLKtide

Modified PLKtide

Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Modified SGKtide Modified SGKtide

Modified SGKtide

Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
MRCL3 Peptide MRCL3 Peptide

MRCL3 Peptide

Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
PAKtide PAKtide

PAKtide

Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
PDHKtide PDHKtide

PDHKtide

Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
PDKtide PDKtide

PDKtide

Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
PKCtide PKCtide

PKCtide

Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
PLKtide PLKtide

PLKtide

Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide

Poly (4:1 Glu, Tyr) Peptide

Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
PS7-CTD Peptide PS7-CTD Peptide

PS7-CTD Peptide

Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
RS Repeat Peptide RS Repeat Peptide

RS Repeat Peptide

Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
SAMStide SAMStide

SAMStide

Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
SGKtide SGKtide

SGKtide

Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
TGFBR1 Peptide TGFBR1 Peptide

TGFBR1 Peptide

Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Thr-phosphopeptide Thr-phosphopeptide

Thr-phosphopeptide

Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Thr-phosphopeptide-3 Thr-phosphopeptide-3

Thr-phosphopeptide-3

Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Tyr-phosphopeptide-2 Tyr-phosphopeptide-2

Tyr-phosphopeptide-2

Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
ULKtide ULKtide

ULKtide

Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
ZIPtide ZIPtide

ZIPtide

Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).

Menu

Settings

Please sign in first.

Sign in